KEGG   Olea europaea var. sylvestris (wild olive): 111370626Help
Entry
111370626         CDS       T05244                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111370626
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111370626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 111370626
NCBI-ProteinID: XP_022848207
Position
21
AA seq 283 aa AA seqDB search
MALARIARHGCYRRSFGAVSNNATESRYQLCGRESAQKYHSLLGGNVTGSGNLLSFKKAE
HISFGNRGMRVTPQHNFAHSQVAVAESDSEQESPQYPTLEATKPGEKPRVVVLGSGWAAC
RFLKGLDTKIYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQTALAKDPNSYF
FLASCSGVDMDKHEVYCETIGDDGLSRGPYRFKVAYDKLVIASGAEPLTFGIKGVKEHAF
FLREVTHAQEIRKKLLLNLMLSENPGKHSKLLSYKKGKWNLII
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggcaagaatagcaagacacggttgttacagacgatcgtttggtgccgttagc
aataatgctaccgagtctcggtatcaactgtgtgggagagaatctgcacaaaagtatcat
tcacttctcggtggaaatgttactggctctggcaatttattgagctttaaaaaggcagaa
catatcagttttggaaacaggggaatgagggtgactccacaacataattttgctcattca
caagtagcagtggcagaatctgattcagagcaagaaagcccccagtatcctactttagaa
gcaacaaagcctggtgaaaagcctagagtagttgttcttggtagtggatgggcagcatgt
agattcctcaaagggctcgacacgaagatttatgacgtggtttgcatatcaccaaggaat
cacatggtatttactcccctgcttgcctcaacttgtgttggaacgttggaattccgatcg
gttgcggagccggtcagtaggatacagactgcactggctaaggatcccaattcttacttc
tttctggcttcatgcagtggagtggacatggacaagcatgaagtgtactgtgagaccatt
ggtgatgatggactttctcgtggaccttaccgatttaaagtagcgtatgacaagcttgtc
attgcttctggagctgagcccttgacctttggtataaagggtgttaaggaacatgccttt
ttccttcgtgaggtgactcatgcccaagaaataaggaagaaacttcttttaaacctgatg
ctatctgaaaatccaggtaaacactccaaactgctatcatataaaaaaggaaaatggaat
ttaattatatag

DBGET integrated database retrieval system