KEGG   Olea europaea var. sylvestris (wild olive): 111371073Help
Entry
111371073         CDS       T05244                                 

Definition
(RefSeq) leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 APH Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 111371073
NCBI-ProteinID: XP_022848756
Position
22
AA seq 653 aa AA seqDB search
MEFSEELDGFLVRNGPSNPGPDHLAGPDPTIHFFFINLFALIHLVQSKLSLYPSYYKALL
LIQKDLDFHGQRRSRCHSAGIFCEWRFTNNSYVLKVTRLVFESQNLTGIISTVVGKLSEL
KELSLQNNELFGQIPTEIFQRQRLEMFNIRKNQFSGEVPEGLSSLIRLRVLDISSNKFSG
SLKFLNNFPNLEKLNLADNMFAGKLPLSLRSFRNLRFINISGNTLLEGPLLVINQLEHLS
SENIQNRYILAEKSMERNLTSARAMAPSSSKGLNGIHAEASSPTATTKHKHKKTKRKILC
QVIGLLVGTFAGIPSGSVLYFLLKFITFLIEGQKMDRSLAIFSMLIKNPKDLAFLGREDG
WNGLNVIGRGGCGEVYKSTLPGTNGKEIAIKKIIQPSRDAEELAEEDSKHLNKKMRQIRS
EIQTSSQIRHRNLLPLLAHLSRPDCHYLVYEYMKNGSLQDVLEAVSKGRRELDWLARYKV
AIGVASGLEYLHLNQTPSIIHRDLKPANILLDDEMEAQITDFGLAKAMPEANTHVTTSNV
AGTVGYIAPEYYQTSQFTEKCDIYSFGIVLGVLAMGKFPWDDFFQHTDEMTLVGWMRNVM
TSDDPKRSINPRLLGNGYEEQILLVLKIACYCTLDNPKEWPDSKEVRCMLTQI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggagttttccgaggagctggacggatttttggtccgtaacggaccatccaatccgggt
ccggaccatttggccggtccggacccgaccattcatttttttttcattaatttatttgct
ctaatccatcttgttcaatcaaaactgagtctttatccttcttactataaagcccttttg
cttatccaaaaggacttggacttccatggtcagcgacggagtcgatgccactccgccgga
atattctgtgaatggagattcacaaacaattcctatgtactcaaagtcacccgtctggtg
tttgagtcccaaaatttgacgggaataatttctacggtagtcggaaaactctctgagctt
aaagaactttcccttcaaaacaacgaactcttcggccaaatccctactgaaatttttcaa
cgccagagacttgagatgttcaacattaggaagaatcaattttccggcgaagttccggag
ggactttcgtcgttaattcgccttcgtgttcttgatatttcgtcgaataaattttccggg
agcttgaaattcttgaacaactttcccaatctggaaaaactgaaccttgctgataatatg
ttcgccggaaaactccctttatcgttgaggtcttttcggaatcttcgattcatcaacatc
tccggcaacactttactggaaggtccattgcttgtaataaatcaattggagcatttatcg
tcggaaaatattcaaaatcgttatattttagctgagaaatcaatggaaagaaaccttaca
tctgcaagggcaatggccccttcttcgagtaaaggccttaatggcattcatgctgaagct
tcgtcccccacggcgacgacaaaacataaacataagaagacgaagaggaaaatactctgt
caggtaatcggacttctagtcggaacttttgctggtattccttcgggatcggtattgtat
tttctcttgaagtttatcactttcttgatcgaaggacaaaagatggacagaagtttggcg
atttttagcatgttgatcaagaatcccaaggacctagcttttctcgggagagaggatgga
tggaatggactgaatgttatcggacgaggtggatgtggagaagtttacaagtcaacttta
ccgggaacaaatggaaaggaaattgctataaagaagataattcagccttctcgggatgca
gaagagcttgctgaggaagacagcaaacatctgaacaagaagatgcgacagattaggtca
gaaattcagacgtcgagtcaaatcagacataggaatctgcttcctctattagcccatttg
tcacggcctgactgccattatcttgtgtatgaatacatgaagaacggtagtctacaagat
gttctcgaagctgtctcgaaagggagacgagaattagactggctcgcacgatacaaggtt
gccataggagtagcttcgggacttgagtatctacacttgaatcaaaccccaagtattatt
cacagagacctcaagccggctaatatccttctcgatgatgaaatggaagcccaaattaca
gatttcgggcttgcaaaagccatgcccgaagctaacacacacgttacaacttcaaatgtg
gccggaacggtaggatacattgccccggagtactaccaaacttcacagttcactgagaag
tgtgatatatatagcttcggcatagtgcttggcgttctggcgatgggcaagttcccatgg
gacgacttcttccaacacacagacgaaatgactttagtggggtggatgagaaatgtgatg
acatctgacgatccgaaaaggtcaatcaatcctagactcctcggaaatggatacgaagag
cagattcttttggttctcaagattgcttgttattgcaccttggataatccaaaagagtgg
cccgacagtaaggaagttagatgcatgttaactcaaatttag

DBGET integrated database retrieval system