KEGG   Olea europaea var. sylvestris (wild olive): 111373819Help
Entry
111373819         CDS       T05244                                 

Definition
(RefSeq) LRR receptor-like serine/threonine-protein kinase RPK2 isoform X1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111373819
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111373819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRRNT_2 LRR_1 Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 111373819
NCBI-ProteinID: XP_022852166
Position
Unknown
AA seq 784 aa AA seqDB search
MVNQKESLTILLARFLKNKRMVCFAAMQRADSAFFVAMNLVCILLYILSVSGGSSDEKKI
LLEFKKSVSDPHGILSSWNAGSSDYCSWFGVSCNSNLRVSRLKIEGNFSVSHQCSMNSVL
ALHGFEIRRNCTEMNGKIVGKLPPIIGKLKELKVLSLPFNELRGEIPVQIWSLKNLEVLD
LEGNLIVGNFSDYEFTGLRNLRVLNLAYNMIAGKFPPSLAICRVLRILNLAGNEINGVIP
RFIGGFRKLRVLNLSFNQLVGHVPDNLGCDCGNLEHLDLSVNFLKGEIPLALGNCSHLRT
LLVSSNALSGFIPMELGELRNLEVLDVSRNRLSGPLPEKLGNCINLSVLVLSSQINVLPS
KRNPGGAVSPRLADVALEDYNCFDGFIPIEITTLPKLQIVFASGANFEGPTNWGRCARQK
HAPSESRSHPKSGKNGVDLIFEVCVISVAVVIAVVLVFVFCYAKRKISDSKGQNTMSPQR
RETNFFEDIGVPLTYDGLIQATGNFNISNCIGNGGFGATYRAEVSPGMTVAVKRLITERC
QGIPQFCAEVRTLRRIKHPNLITLIGYGASQAEMFLIYNYLPGGNLEEFIRERARRAFDW
RIVHKIALDVASALTYLHDQCNPSILHRDIKPSNILLDNDCNAYLSDFGLSKSLSATQTH
ATTCVAGTYGYIAPEYALTGRVSNKADVYSYGVMLLELLSDKKALDPSFYSYEDGFNIVS
WACLLLKQGQAEDFFFSSLWDSGPQDDLVKMLHVAVLCTLESYSARPTMKQVVQRLKHFQ
PPSG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccaaaaagaatcactgacgatccttcttgcaaggtttctgaagaataagaga
atggtgtgttttgctgctatgcaaagggcagattctgcatttttcgtggccatgaatttg
gtttgcattttactgtacattctatcagtctctggcggatcttcagatgagaaaaagatt
ctgctggaattcaagaaatctgtttcagacccccatggaattctttccagttggaatgca
ggcagttccgactattgctcttggtttggagtgtcctgcaattccaatttaagagtttcc
cggctgaaaattgaaggtaacttttcggtttctcatcagtgttctatgaattctgtgtta
gctttgcatggctttgaaatacgaagaaactgcaccgaaatgaatggaaaaattgtagga
aaactgccacccattatcggaaaactcaaagaacttaaggttctgtcacttccattcaat
gaactcaggggtgagattcctgtccaaatatggagccttaaaaatcttgaagtacttgat
cttgaagggaatcttattgtgggaaatttttcggattatgaattcactggtttaaggaat
ttaagggttcttaaccttgcatataacatgattgctgggaaatttccaccttccctcgca
atatgtagggttttaaggattttgaatttagcaggaaatgaaattaatggtgtgattccc
agattcattggtggttttaggaagttaagagtgctgaatttgtcgtttaatcagttagta
ggccatgttccagataatttggggtgtgattgtgggaatcttgagcatttggatttgtcg
gttaatttcctaaagggggaaattccgcttgctttgggaaattgtagtcatttaaggaca
cttttggtatcttcaaatgcattaagtggctttatccctatggagctaggtgaacttcga
aaccttgaagttctggatgtttcgagaaacagattgagtggtcccctgcctgaaaagctc
ggaaattgtattaatttgtcggttcttgttctttcaagtcaaattaatgttctcccgagc
aagaggaatccaggtggagcagtgtctcccagattagctgatgtcgcattagaagattat
aactgttttgatggtttcattcccattgagattaccacacttccaaagctgcagatagtt
tttgcttctggagccaactttgagggaccgacaaattggggccgttgtgctaggcagaag
catgcaccttctgaatcaagaagccatcctaaaagtggtaaaaacggagttgatcttatt
tttgaagtatgcgtaatatctgtagcagtcgttattgcagttgttttggtttttgtattt
tgttatgcaaaaaggaaaatatcagattcaaagggtcagaatactatgtcaccacagaga
agagaaactaactttttcgaggacattggagtacccttaacatatgatggtttgatccag
gcaacgggaaattttaacattagcaactgcataggaaatggtggatttggtgccacctac
cgggctgaagtttctccaggaatgacagtagcagtgaaaaggctcattactgaaaggtgc
caaggcatcccacagttctgtgccgaggtcaggacactgagaagaatcaaacacccgaac
ctcataactttgatagggtatggtgccagtcaagcagaaatgtttctgatatataactac
cttcctggtggaaatctagaagaattcattcgggaaagagccagaagagcttttgattgg
agaatagttcacaagattgctctcgatgttgcatctgcactaacttatctgcacgatcag
tgtaatccgagtattctacatcgcgacatcaaacctagtaatattttgttggacaacgac
tgcaatgcctatttgtcagactttggattgtcaaaatctctgtctgctacacaaactcat
gctaccacttgtgtagccggaacttacggatacatagctccagaatacgcactgacaggc
cgcgtatccaacaaggccgatgtttacagctatggggtgatgctgcttgagttattgtct
gacaagaaagctctcgatccttcattttattcatatgaagatggattcaacattgtttca
tgggcgtgcttgttactcaaacaaggtcaggccgaggattttttcttctcgtctctatgg
gattcgggtccacaggatgacctcgtgaaaatgctgcatgtggctgttctttgtactctt
gaatcatattctgctcggccaacaatgaagcaagttgtgcagcgactcaaacactttcaa
ccacccagtggctaa

DBGET integrated database retrieval system