KEGG   Olea europaea var. sylvestris (wild olive): 111375621Help
Entry
111375621         CDS       T05244                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu03040  Spliceosome
oeu04141  Protein processing in endoplasmic reticulum
oeu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111375621
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111375621
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111375621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA FGGY_C PilM_2 Hydantoinase_A LXG
Motif
Other DBs
NCBI-GeneID: 111375621
NCBI-ProteinID: XP_022854239
Position
Unknown
AA seq 705 aa AA seqDB search
MAASTAQIHALGATTYFASANTTGRNSPKTVFLGTKLNNTVSFGLKIKNRARRSSGRNPR
VMPLRVVAEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQI
AKRQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYTVVRDANGNVKLECPAIGKQFAAE
EISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLDVLRIINEPT
AASLAYGFERKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVD
WLATNFKKDEGIDLLKDKQALQRLTETAEKAKMELSSLTQTNISLPFITATADGPKHIET
TLTRAKFEELCSDLLDRLKTPVQNALRDAKLSFSDIDEVILVGGSTRIPAVQELVKKLTG
KDPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTL
PTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDI
DANGILSVAAVDKGTGKKQDITITGASTLPSDEVEKMVKEAEKFAKEDKEKRDAIDTKNQ
ADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKDAISGGSTQAIKDAMTALNQEVMQL
GQSLYNQPGAAPGAGPAPGGQAGPSESSDKGPEGDVIDADFTDSK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcaactgctcaaattcatgctctgggtgccaccacttactttgcttctgca
aacacaactgggagaaattccccgaagacggtgtttttgggaacgaagcttaacaatacg
gtgtcgtttggactcaagataaagaatagggctaggagaagctcgggtcgaaatccccgc
gtgatgccactccgagttgttgcggaaaaagttgtgggaattgaccttggaactacgaat
tctgctgttgcggcaatggagggagggaaaccgactattgtgactaatgctgaggggcag
aggactacgccatctgtagttgcttacaccaagagcggcgacaggttggtggggcaaatt
gcaaagaggcaggctgtggtgaaccctgagaacacgtttttctcggtcaagagatttatt
ggtcggaaaatgtcggaggtggatgaggagtccaagcaggtctcgtacacagtggtcagg
gacgcgaatgggaacgttaagcttgagtgccctgcaattgggaaacaatttgctgctgag
gaaatatctgctcaggttttgaggaagcttgttgatgatgcatcgaagtttttgaacgac
aaggttactaaagctgttgtcacagttcctgcttactttaatgattctcagagaacagcg
accaaggatgctggtcgtattgctggtttggatgttctccggattataaatgagcctact
gctgcctcgttggcttatggttttgaaagaaaaagcaatgagaccattctggtttttgac
cttggaggtggtacatttgatgtttcagttcttgaggttggcgatggtgtgtttgaggtt
ctatctacttctggagatacacatcttggtggtgatgactttgataagagaattgttgat
tggcttgctacaaatttcaagaaagatgaaggaatagatcttttgaaggacaaacaagct
cttcagcgtctgactgagacggcagagaaagctaaaatggagctatcatctttaacacag
actaatatcagcttgcctttcattactgccacagcagatggccccaaacatatcgagacc
actcttacccgagctaaattcgaggaattatgctctgatttgcttgacaggctgaaaaca
cctgtccaaaatgccttgagggatgcaaaactttcatttagtgatatagatgaggtcatc
ctagtcggtggttcaacccgtattccagctgttcaggaacttgttaagaaattgactgga
aaagaccccaatgttacagtcaatcctgatgaagttgtggcccttggagctgctgtccag
gctggtgtcttggctggagatgtcagtgatatagtccttctagatgtgacaccgttgtct
ttggggcttgaaacccttggaggtgtgatgacaaagattattccaagaaatacaacattg
cccacttcaaaatcagaagtgttctcaacggctgctgatggtcagacaagtgttgaaatt
aatgtccttcagggtgagagagaatttgttagggataacaagtctttgggcagcttccgt
cttgatggaataccacctgctccacgcggagttcctcaaattgaagtcaaatttgacatt
gatgcaaacggcatcctttctgtcgccgcagttgacaaaggaactggaaagaaacaagat
atcaccattactggtgcaagcacattgcctagcgacgaggtagagaaaatggtcaaagaa
gctgaaaagtttgccaaggaagacaaggagaagagagatgctatagataccaagaatcag
gccgattctgttgtttaccaaacagagaaacagttgaaggaacttggtgataaagttcct
gccccagttaaggagaaggtcgaggcgaaacttggagagcttaaggatgcaatatcaggg
ggctcgacccaagccattaaggatgctatgacagccctgaatcaggaagtcatgcagctt
ggccagtcgctatacaatcaaccaggtgctgcacctggtgctggcccagctcctggtggt
caagcaggcccttcagaatcgtcagacaagggacccgaaggagacgttatagatgcagat
ttcacagatagcaagtga

DBGET integrated database retrieval system