KEGG   Olea europaea var. sylvestris (wild olive): 111378571Help
Entry
111378571         CDS       T05244                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 51-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:oeu03041]
    111378571
   03009 Ribosome biogenesis [BR:oeu03009]
    111378571
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111378571
Spliceosome [BR:oeu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    111378571
Ribosome biogenesis [BR:oeu03009]
 Eukaryotic type
  90S particles
   Helicases
    111378571
  Pre-60S particles
    111378571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 111378571
NCBI-ProteinID: XP_022857565
Position
Unknown
AA seq 600 aa AA seqDB search
MPGIVKIPNNGAMDSTKKKRKRNRDKKKQKKSTPENSEREEENKEYLKKGGSDEGEEIGE
QKEEEEEEGFGEKKKKSKKILKTEHKEEKEEEESGKEEKVKREKMIRSNSGIMSTETFAS
LGLSEPTMNAIKDMGFQYMTEIQARAIPPLIGFEDVLGAARTGSGKTLAFLVPAVELLYR
GNFKPRNGTGILVICPTRELAIQTHAVAENLLKYHSQTVGLVMGSGPRRKEVERIIKGAN
LLVATPGRLLDHLQNTKGFIYKSLQCLMIDEADRILEENFEEEMKQIIKILPKKRQTALF
SATQTKKVEDLARVSFQKTPVYIDVDDGRKRVINEGLQQGFCIVSSAKRFVLLYSFLKRN
LSKKVMVFFSSRDSVKFHSELLRYIQIDCFDLHGKQKQPKRTSSFFNFCEAEKGILLCTN
IAARGLDIPGVDWIVQYDPPDDPKEYIHRVGRTARGEGAEGKALLFLIPEELQFLQYLKD
EKVHVKEYEFDDKKIANVQSHLEKLVSNNYYLNKSAKDGYKSYIQAYNSHSRKEIFNVHR
LDLQAVAASFCLSSPPKVNLNIDSSASKFRKVKRVEGRRNGFSEKNPYGRKGDTRQSIRY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtattgtgaaaatcccaaataatggagccatggattccacaaagaagaagcgc
aaaagaaatagagacaaaaagaaacaaaaaaaatccacaccagaaaattcagaacgcgaa
gaagagaataaggagtacttgaaaaaaggaggcagcgatgaaggggaggaaattggagag
cagaaagaagaagaagaagaagaaggatttggagagaagaagaaaaaaagcaagaaaata
ttgaagacggagcacaaagaggagaaggaagaagaggaaagtggaaaagaagagaaggtg
aagagagagaagatgatacgaagtaattctgggattatgagtacggagacatttgcatcg
ctgggtttatccgagcccaccatgaatgccatcaaggacatgggttttcagtacatgact
gagatccaagcccgggcaattccaccgcttataggatttgaagatgttcttggagctgca
aggacaggttctggcaaaacccttgcgtttctggtaccagctgtggagttgttgtatcga
ggcaatttcaagcctcgcaatgggactggcatccttgtcatttgcccgaccagggagttg
gccatacagacacatgctgtggcagaaaaccttctcaagtatcattcacagactgttgga
ttagtaatgggtagtggcccacgaagaaaagaggtagagcgcattatcaaaggagctaat
cttttagtagcaacacccggccgtcttcttgaccatcttcaaaatactaaaggcttcata
tataaaagcttacagtgcctcatgattgatgaagctgataggattttggaagaaaatttt
gaagaagaaatgaagcagatcattaaaattttgccaaagaagagacaaacggctcttttc
tctgctacacagactaagaaggttgaggatcttgcgcgtgtatcatttcagaaaactcct
gtctacattgatgtggatgacggaaggaagcgggtcatcaacgaagggctgcagcaaggc
ttctgtattgtctcaagtgccaaaagatttgttcttctgtattccttcttgaagaggaat
ctgtcaaagaaagtgatggtctttttctcatcacgcgattctgtcaaatttcattcagaa
cttcttagatacattcagattgattgttttgatttacatggaaagcaaaagcagccgaaa
cgaacttcctcattttttaatttttgcgaagcggagaagggtatcttgttatgtaccaat
atagctgcacgtggtcttgatattcctggtgtggattggattgtacagtatgatccccca
gatgaccctaaggagtatatccatagagttggtcgaactgcgcgtggggaaggtgcagaa
gggaaggcccttcttttccttattcctgaggagttgcagtttcttcagtaccttaaggat
gaaaaagtgcatgtgaaagagtatgaatttgatgataagaagattgcaaatgtgcaatcc
cacctggaaaagctggtttcaaacaattattacttgaataagtcggctaaagatggatac
aaatcttacatacaagcttacaattcacattctaggaaggaaatctttaatgttcaccga
cttgacctgcaggctgtagctgcttcattctgtttatcatctcctcccaaagtaaacttg
aacatagacagtagcgcatcaaaattcaggaaggtgaaaagagttgaaggcagacgaaat
gggttcagcgagaaaaatccatatggtaggaaaggcgacacgagacaatctatcagatac
tag

DBGET integrated database retrieval system