KEGG   Olea europaea var. sylvestris (wild olive): 111378706Help
Entry
111378706         CDS       T05244                                 

Definition
(RefSeq) receptor-like cytoplasmic kinase 176 isoform X1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 111378706
NCBI-ProteinID: XP_022857701
Position
Unknown
AA seq 530 aa AA seqDB search
MGICLSNQIKDESPVHTGIISSKNVSGNGTELSNPSSKDSSTSIPPTPRSESEILLSNNL
KSFAFSNHIISASIPLPTCSGVISSRNVSGNGTELSNPSNKASFASIPLIPRSEGDISSK
NIRENGTELSNPSSKDSSASIPQTSRSEGVISSEYVRGKQTELSNSNSKAASAFLPPIPR
NEGIISSKRLCGKGTELSNSSSKATSAYIHLIPWSEGEILKSSNLKGFTFSNLKAATRNW
DILLGEGGFGSVFKGWVDKNSLEATKPGVGMAVAVKRLNQYGFQGHKEWLAEVNYLGKLR
HPNLVKLIGYCLEDDHRLLVYEFMPNGSMENHLFRRGSYFQPLSWNLRMKIALGAARGLA
FLHCAEIGVIYRDFKTSNVLLDSNYNAKLSDFGLARDGPTGGKSHVSTRVMGTYGYAAPE
YISTGHLSTKSDVYSFGVVLLEILCGKIAIDKSRPSGKHNLVEWAKPYLMDKRRMLCILD
PCLEGQFSKGQALKATTLAHRCLSANFKFRPNMDEIVNALEQVQEQVSGV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggggatctgcttgagcaaccaaatcaaggatgagagccctgttcatactggtattatt
tcttctaaaaatgtcagtggaaatgggaccgagctaagtaatccgagcagcaaggactca
tctacttctattcccccgactcctcggagtgagagtgagatcttgctgtccaacaacttg
aaaagtttcgcattcagcaaccatatcataagtgcatccattcctttgcctacctgctca
ggtgtcatttcttctagaaatgtcagtggaaatgggaccgagctaagtaatccaagcaac
aaggcatcatttgcttctattcccctgattcctcggagtgagggtgatatttcttctaaa
aatatcagggaaaacgggaccgagctaagtaatccaagcagcaaggactcatctgcttct
ataccccagacttctcgaagtgagggtgttatttcttctgaatatgtccgtggaaaacag
accgagctaagtaattcaaacagcaaagccgcatctgcttttttacctccgattcctcgg
aatgaaggtattatttcttctaaacgtttatgtggaaaagggacagagctaagtaattca
agcagcaaggccacatctgcttatatacatctgattccttggagtgaaggtgagatcttg
aaatcctccaacttaaaaggcttcacattcagcaatcttaaggcagccacaagaaactgg
gacattttattaggggaagggggttttggttctgttttcaagggatgggttgataaaaac
tcacttgaagctacaaagcctggggttgggatggcggtggctgttaagaggctaaaccaa
tatgggtttcagggtcacaaggaatggttggcagaagtcaactatcttgggaagctgcgc
catcctaaccttgtgaaattaattggttactgcttggaggatgaccatagacttttggtt
tatgagttcatgcccaatgggagcatggagaatcatctattcaggagaggttcttacttc
cagccactttcctggaacctaagaatgaaaattgctctaggtgctgcaagaggacttgcc
tttcttcactgtgctgagataggagtaatatatcgagacttcaagacttcaaatgtcttg
cttgactcgaactacaatgcaaaactatctgatttcgggttggcaagggatgggccaact
ggtggtaagagtcacgtctcaactcgagtcatgggaacttatggatatgctgctcccgag
tacatatccacaggccatttatctaccaagagtgatgtatacagctttggagtggtactt
ttagaaattttatgtggtaagatagcaatagacaagagtcggccaagcgggaaacataat
ttggttgaatgggcaaaaccttacctgatggacaaacgtagaatgttgtgcattctagac
ccttgtcttgaagggcagttctcaaagggccaagccttaaaggcaactacccttgcacat
cgatgcctatccgcgaatttcaagtttaggccaaacatggacgagatcgtaaatgcttta
gaacaggttcaggaacaggtttcaggagtttaa

DBGET integrated database retrieval system