KEGG   Olea europaea var. sylvestris (wild olive): 111378736Help
Entry
111378736         CDS       T05244                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111378736
   01009 Protein phosphatases and associated proteins [BR:oeu01009]
    111378736
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111378736
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: Other
  Wnk family
   111378736
Protein phosphatases and associated proteins [BR:oeu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111378736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 111378736
NCBI-ProteinID: XP_022857735
Position
Unknown
AA seq 697 aa AA seqDB search
MNGVINLESNDSEFVEVDPSGRYGRYNEVLGKGASKTVYRAFDEFEGIEVAWNQVKLYDF
LQRPEDLERLYCEIHLLRTLKHKNIMKFYSSWVDTANRNINFVTEMFTSGTLRQYRLKHK
RVNIRAVKKWCRQILIGLHYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILQK
SHAARCVGTPEFMAPEVYAEEYNELVDIYSFGMCVLEMVTFEYPYSECTHPAQIYKKVTS
GTKPDALYKVRDPEVRQFVEKCLATVSHRLSARELLDDPFLQMDDCVYDLRPFDSYEDYD
GLGPMFRQPHSNSSLIEGYSNYLVYEQENGMDCHSVEYDAHEIDLFTNHEDDHLGNVDIT
IKGRRREDDNVFLRLRIADQEGRVRNIYFPFDIEADTALDVATEMVAELDITDQAVTKIA
EMIDNEIASLVPEWKRDSRIHESIDHTNSNFCQNCSLVEYLSTGDLGKNLQVLQCSKHEC
GAIHGRFEEITYQFEGSEQCVTEGAPMGSSQSVGVHYTDIWSQHDGLELVPKFSGDNHFG
DEHEIFHESTNNKNEKIIRIDKEEDKSLLTQVEDYENAVRHELRWLKAKYQMQMRELKLG
DQHKGIVSKSSTLKFNNEKDKLSPSFSSMSPEEKRSTSFFPTDAENNCANQKVHSYESVY
NSFSPVHMITAENFYTGTLLSHSLHRATSLPVDAIDF
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgtcattaatcttgagtcaaatgattccgagtttgtcgaagttgatccttct
ggaagatacggaaggtataatgaagttcttggtaaaggggcttcaaaaacagtttaccga
gctttcgatgaatttgaaggaattgaagtagcctggaaccaggtgaaactgtacgatttt
ctgcaaagaccagaggatctggagagattatattgtgaaattcatcttctcaggactctg
aaacacaagaatattatgaaattctactcttcctgggttgatactgccaacaggaacatc
aattttgtgacagaaatgttcacttccggtactctcagacagtatagactgaaacataag
agggtcaatattagagcagtgaagaaatggtgtaggcagattttgataggacttcattat
ctccatagccatgatccacctgttatacatagagatctcaagtgtgataacattttcatt
aatggaaaccaaggagaagtcaagattggtgatcttggcttagctgcaatactgcagaaa
tcccatgccgctcgatgtgtaggaacgcccgagtttatggctccagaggtgtatgcagag
gaatacaatgaattagtcgatatttattcgtttggtatgtgcgttttggaaatggtgaca
tttgagtatccttatagcgaatgcactcatcctgctcaaatttataagaaagtgacctcc
ggaacgaagccagatgctctttacaaagttagggatcctgaggtgcgtcaatttgttgag
aaatgtttagctacggtgtctcataggttgtctgctagggagcttctcgatgatccattt
ctgcaaatggatgattgtgtttatgatttgaggccatttgattcttatgaagattatgat
gggctaggtcctatgttcagacagcctcacagtaacagttctctaatcgaagggtactcc
aattatcttgtctatgaacaagaaaatggaatggattgccattcagttgaatatgatgca
catgaaatagaccttttcacgaatcatgaggatgatcacttgggaaatgtggacattacg
atcaaagggagaaggagggaagacgataacgtctttctgagactcagaattgctgatcaa
gaaggccgagtacgaaatatttatttccctttcgacattgaagctgacactgcccttgat
gttgctactgaaatggttgccgagttggatatcaccgatcaagccgtgactaagatagcc
gagatgatcgacaatgagattgcttccttagtacccgagtggaaacgggactctagaata
catgaaagtatcgatcacacaaacagtaatttctgtcagaattgttctctggtcgaatat
ttatccacaggcgacctaggcaagaacctgcaagttcttcaatgttctaagcatgaatgt
ggtgctatacacggccgttttgaagaaatcacgtatcaatttgaagggtcggagcaatgt
gttacagaaggcgctcctatgggatcaagccaatcggttggtgtacactacactgatata
tggtcacaacacgatggtctcgaattagttccaaaattttccggtgacaatcactttggt
gatgaacacgaaatctttcacgagtcaacaaacaataagaacgagaaaatcataaggatc
gacaaggaggaggataagtctcttttgactcaagtagaagattacgagaatgcggtaagg
catgaactgaggtggctcaaagccaaatatcaaatgcagatgagagagcttaaacttgga
gatcaacataaggggatcgtgtcaaaatcttcgactttgaagttcaataacgagaaggat
aaattgtcaccgagcttctcaagtatgtcgccagaagagaagcgttcgacctcatttttc
ccgactgatgcagaaaacaactgtgctaaccagaaagttcacagttatgaatctgtttat
aattcttttagtccagtacatatgatcactgcagagaatttttatactggtacattgctt
tcacattcccttcatagggccacatctttaccagtggatgctatagatttctaa

DBGET integrated database retrieval system