KEGG   Olea europaea var. sylvestris (wild olive): 111380119Help
Entry
111380119         CDS       T05244                                 

Definition
(RefSeq) uncharacterized protein LOC111380119
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00790  Folate biosynthesis
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    111380119
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oeu04147]
    111380119
Enzymes [BR:oeu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     111380119
Exosome [BR:oeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111380119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 111380119
NCBI-ProteinID: XP_022859361
Position
Unknown
AA seq 207 aa AA seqDB search
MASTTHLPFSPPLSIFKNPIKKSQVVVSFTKPRLQVKIHATGTDMVGDFGARDPFPAEIE
SNFTEKVLGNVDTEHKILIPTAAALSLSQQQCTPISHLQQPIPEDEAKKMLFKVVGWRLV
HEEGGIKLQGLWKLRDFKCAVELINRICRVVEPTGHFPTLHLEQPNQVRAELWTASIGGL
SMNDFIVAAKIDEIKTSDLVLRKRVWA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacaacccatttacccttctctccccctctttctatctttaaaaacccaatt
aaaaaatcccaagttgttgtctctttcaccaaacctcgacttcaagtgaaaattcacgca
acgggaacggatatggtcggcgattttggagccagggacccatttccagcagagatagaa
agcaattttactgagaaagtgctgggaaatgtagatactgagcataagattttgattcca
actgctgccgctctgtctctttcgcaacaacagtgtactcccatttctcatcttcagcaa
cctattcctgaggatgaagccaaaaagatgctgttcaaggttgttggctggagacttgta
catgaagaagggggtataaagcttcaaggtttatggaaattgagggatttcaagtgtgcg
gttgaactcattaataggatatgcagggttgtagagcctacggggcactttcctactctt
catctagagcagcccaatcaagttagagctgaactatggactgcttcaattggaggtttg
agcatgaatgatttcattgttgctgctaaaatagacgagataaaaacatcagatcttgtc
ctccgaaagagagtttgggcgtaa

DBGET integrated database retrieval system