KEGG   Olea europaea var. sylvestris (wild olive): 111380644Help
Entry
111380644         CDS       T05244                                 

Definition
(RefSeq) receptor-like serine/threonine-protein kinase SD1-8 isoform X1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase B_lectin S_locus_glycop PAN_2 Haspin_kinase DUF3403 APH DUF5128 Pkinase_fungal PRIMA1 MSP1a
Motif
Other DBs
NCBI-GeneID: 111380644
NCBI-ProteinID: XP_022860036
Position
Unknown
AA seq 837 aa AA seqDB search
MITKNTRCFIFSILFFLCFYININLSLGGDSIRANKSLSGKQTIVSSGGTFELGFFKPGT
FSSYYIGIWYKNISPMTIVWVANRETPISDMNSAELKILHGNLVLMDESQVSIWSTNVNL
TTSDSVVAALGDNGNLVLRDESEPRTSEGFWQSFDNPTDTLLPGSKIAYNKHTKKEKILT
SWKNFEDPATGLFSNELDPNGRQCIIRWNRTEWFWTSGAWNGHFFSSIPRMSLDSFFNHS
YVDNVNESYYTYSLNNRFIISRYVMDVSGQINLTVWYKEKWNSLWFQPMQQCDVYAYCGA
FGTCNQNSSNFCYCLPGFKQRSENDWSLKDYSGGCEREIVLNCRNDRKDKFLANNLVMLP
SNSQRVMAGSAGECESICLSNCSCTAYSYEDNACLVWKGELMDLKLPTENNGSKRTIHIR
LSASASQFSKNKRSKLLVIGSVAGSVVLVLLATVVICICHKHKSGTTKAVDGSSLALRYK
DVLQIETKNSPDNLERDNQSGIGVPFFSWESIIAATKNFSDIHKLGRGGFGPVYKGMFPG
GQEIAVKRLSSCSLQGINEFQNEIVLIAKLQHRNLVRLLGYCMKENEKILLYEYMPNKSL
DAFIFDKELCTLLNWKKRFDIILGIARGVLYLHQDSRLRIIHRDLKTSNILLDEEMNPKI
SDFGLARIVEGKGIEASTNKVTGTYGYMSPEYASDGLFSIKSDAFSFGVVVLEIVTGKRN
TGFYQSSEDLNLLGYVWRLWHENKVFDSVDPILLESCEKSEVMKCINVGLLCVEEDPNDR
PSMSDVVLMLSGETIIVPVPKKPAFVMRKRVFSISSSSSNKPDSISNELTMSDPQGR
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaaagaacactcgttgtttcattttctccatattgtttttcctatgtttctat
attaacatcaatctttccctaggaggtgacagcatcagagcaaacaaatctctctctgga
aaacagacaatcgtgtcttctggtgggacttttgaactgggattcttcaaaccaggtact
ttttccagttattatataggaatttggtacaaaaatattagtccaatgaccatagtttgg
gtagcaaatagggagacacccatttcagacatgaactctgcagaacttaagatattacat
gggaatttggtgcttatggatgagtcccaggtttcaatttggtcgacaaatgtaaacttg
acaacctcagattctgtagtggcagctctaggtgataatggaaatttagtattgagagat
gagtcagaacctaggacaagtgaaggattttggcaaagttttgataatccaacagatacg
ttgttgcccggaagcaagattgcctataataaacatacaaaaaaagagaaaatcctcact
tcatggaaaaatttcgaggatcctgcgactgggcttttctccaatgaattagatccaaat
gggagacaatgtattataagatggaataggactgaatggttctggactagtggagcttgg
aatgggcattttttcagttcaatccccagaatgagtctggacagtttttttaatcatagt
tatgttgacaacgttaacgagagttactacacatattctcttaataaccgtttcattata
tctcgatatgtgatggatgtttccgggcaaattaatctgacagtgtggtataaagagaag
tggaattcattatggtttcaacctatgcagcaatgtgatgtgtatgcttattgtggggca
tttggcacctgcaatcagaattcatcgaacttctgttattgtttgcccggatttaagcaa
aggtcggaaaatgattggagtttgaaggattattcaggtggctgtgagagagagatcgtt
ttgaactgtaggaatgacagaaaagacaagtttctagcgaataaccttgttatgttacct
tcaaattcacaaagagtgatggcagggagtgctggagagtgtgaatctatctgcttgagt
aattgctcttgtacagcttactcttacgaagacaatgcatgcttggtttggaaaggggaa
ctaatggatttaaaactacccacagaaaataatggcagtaaaagaacgatccacattaga
ctttccgcctctgcatctcagttttcaaaaaataaaagaagcaaattacttgtaatcggt
tctgttgcgggttctgttgttttggttctattggccactgtcgtgatatgcatatgtcac
aagcataaatctgggactacgaaagcagttgatggatcatcgttggcattaaggtacaag
gacgtgttgcaaattgaaacgaaaaattctccagataatttagagagagacaaccagagt
ggtatcggtgttcctttcttcagttgggaaagtataatagctgctaccaagaatttctca
gacatacataaacttggacgtgggggctttggtcctgtttacaagggaatgtttcctgga
gggcaggaaattgcagtgaaaaggttgtcaagttgttctttgcaaggcattaacgaattt
caaaatgagattgtattgattgcaaagcttcaacaccgaaacctcgtccgccttttgggc
tactgtatgaaggagaatgaaaagatcttactctatgaatacatgcccaacaaaagtttg
gatgcctttatatttgataaagaattatgcacgttactaaactggaagaagcggtttgac
atcatcttggggatagcaagaggggttctttatcttcatcaagattcaaggttgaggata
attcatagagatttgaaaacaagcaacattctgttagatgaagagatgaatcccaaaatt
tcagacttcggtttggcaagaattgttgagggcaaaggtatagaggcaagcaccaataaa
gtcacaggaacctatggttatatgtctccggagtatgcatcggatggactattctctata
aagtcagatgcatttagttttggagttgttgtactcgagatagtcactggaaagagaaac
actggattttaccaatcctcagaagacttgaatctcttgggttatgtatggagattgtgg
catgaaaacaaggtattcgattcagtggatccaatactgcttgaatcttgtgagaaatct
gaagttatgaagtgcattaatgttgggcttttgtgtgtggaagaagatcccaatgatcgc
ccctctatgtcagatgtagtcctaatgctaagtggcgaaactataattgttccagttccc
aagaaaccagcttttgtaatgagaaaacgtgttttcagcatatcatcctcatcctcaaat
aaaccggattcaatttccaatgaattgacaatgtctgatccacaagggagatga

DBGET integrated database retrieval system