KEGG   Olea europaea var. sylvestris (wild olive): 111380718Help
Entry
111380718         CDS       T05244                                 

Definition
(RefSeq) cold-responsive protein kinase 1-like
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Haspin_kinase DUF5383 DUF5305 FeoB_associated
Motif
Other DBs
NCBI-GeneID: 111380718
NCBI-ProteinID: XP_022860121
Position
Unknown
AA seq 438 aa AA seqDB search
MPRLELDVSRKWDVNEIITPSSSLEEQSTTSSQPSLALFFFLGGIVILLIALILIFVFRK
TIKPAKLKMFIPRTMKQPVAKDVISGNLHTISYYDFQTLKKATKNFQEKNVLGRGGFGPV
FMGKLEDGRLIAVKKLSLDKSQQGESEFLAEVRLITSIQHKNLVRLLGCCSDGAQRLLVY
EYMKNRSLDLIIYEKSGTYLNWTTRFQIILGIARGLQYLHEDSHIRIVHRDIKASNILLD
DKFQPRIGDFGLARFFPEGQDFLSTRFAGTLGYTAPEYAIRGELSEKADIFSFGVLVLEI
ISCRKNTDLSLPSEMQYLPEYAWKLYERSKLVNLIDPRIRDRSLEKDVLQAIHVAFLCLK
PCANLRPPMSEIVAMLTCKVDVAGKLTRPVFLDGKQRKDEKLLWDSTTEPSPSPLSSDSP
SFPWPPGKDFSLSDIRSS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtttagaactggatgtttcaaggaaatgggatgtgaatgaaattatcactcca
tcatcctcgcttgaagaacagagcaccacgtctagtcagccttcactggctctattcttt
ttcctgggagggatagtcatactcctcattgcacttatcctgatatttgtgttccggaaa
actattaaaccggcaaaattgaaaatgttcattcctcgcacaatgaagcaaccagtagcg
aaggatgtcataagtggaaatcttcacacaataagctattatgatttccagacactgaag
aaggctaccaaaaatttccaagagaagaacgtgcttggaagaggtggattcggaccagtt
ttcatggggaagttagaagatgggaggttgattgctgtaaagaagttgtcacttgacaaa
tcacaacaaggagaatcggaatttcttgccgaagtgaggttgatcactagtatacagcac
aagaacctggttcgtcttctggggtgttgctctgatggagctcagaggctactagtgtac
gaatacatgaagaataggagtttagacctcatcatatatgagaaaagtggaacatattta
aactggacaactcgcttccaaataattcttgggattgctcgagggttgcaatacctgcac
gaggattcacacatcaggattgtacacagggatatcaaagcgagcaacattctcctggat
gacaaatttcaacctaggattggagatttcggcctagccaggttttttcctgaaggtcaa
gattttctcagcactagatttgctggaaccttaggttacactgcgcctgagtatgccatt
agaggagaattgtctgaaaaggccgacatattcagttttggagtattggtgcttgaaatt
attagctgcaggaaaaacacggatctttctctgccctcagaaatgcaatacctccctgaa
tatgcctggaagctatatgagcggtcgaagttggtcaatctcatagatccaagaatccga
gacaggtctctggagaaggatgttttgcaggcaattcacgtggccttcctatgccttaag
ccttgtgcgaatttaaggcccccaatgtctgagattgtggcaatgttaacgtgcaaggta
gatgtagctggaaaacttactagacctgtcttcttggatggaaaacaaaggaaagacgag
aagctcttgtgggattctactacagagccttccccatctccactgagcagtgattcccct
tcatttccctggccgccaggtaaagattttagtctctcagacataagatcttcctag

DBGET integrated database retrieval system