KEGG   Olea europaea var. sylvestris (wild olive): 111380948Help
Entry
111380948         CDS       T05244                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX13
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111380948
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111380948
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111380948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 111380948
NCBI-ProteinID: XP_022860393
Position
Unknown
AA seq 409 aa AA seqDB search
MGICFPKPTAAERKIYSGADAKPAGATPVHSHAKSIKNPNPHAATTNIVQHRASPPNGGR
NGKGVRASGHIITPNLKMFTFAELESATRNFRADNFLGEGGFGKVFKGWIDEKTYSPSKF
GVGMPVAVKKSNPNSDQGLKEWQAEVKFLGKFCHPNLVKLLGYCWEDRQFLLVYEYMEKG
SLESHLFRKDAAETFPWDTRIKIAIGAAKGLAFLHTTEKKVIFRDFKASNILLDRDFNAK
LSDFGLAKLGPTNGKSHVTTRIIGTYGYAAPEYMATGHLYLKSDVYGFGVVLLEILTGLR
IFDTNRPNGNHNLIDWAKPFLPNKKKLKKIIDPRLQNQYPSKGASQIAELILRCLESDQK
CRPDMEDVLKSLEQINTIKMKLRESNSEGRHKKQHATDHHGRSPHLTYR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggaatctgctttcctaagcctacggcggcggagcgtaagatttacagcggcgccgac
gccaaacctgctggtgccaccccagttcatagtcatgcaaagtcaatcaagaatcctaat
ccccacgccgccaccacgaatattgttcagcaccgtgcatcgccgcctaacggaggcaga
aacggcaaaggtgttcgggcaagtggccatattattactccaaacttgaaaatgttcacc
tttgcagaactggaaagtgctacaagaaatttcagagctgataattttttgggagaagga
ggttttggaaaggtttttaaaggttggattgatgagaaaacttactcgccttcaaaattt
ggtgttggaatgcctgttgctgtcaagaaatcaaatccaaatagtgatcaaggactaaaa
gaatggcaggcagaggtaaaatttttgggaaaattttgccatcctaatcttgtgaaacta
ttaggttactgttgggaggatagacaatttcttttggtttatgaatacatggagaaggga
agtttagaaagtcaccttttcagaaaggatgcagcagaaacttttccttgggatacaagg
attaaaatagcaataggagcagccaaaggacttgcatttttgcacacaaccgagaagaag
gttatatttcgagattttaaggcctccaacatattgcttgatagggacttcaatgcaaag
ctttcagattttggattagctaagttaggtccgacgaacggtaaatcacacgttacaaca
cgaattattggcacatatggatatgcagctcctgagtacatggccacaggtcatttatac
ttgaagagtgatgtctatggatttggggtggttttactcgagatattaacaggcctaaga
atttttgatacgaataggcccaatggaaatcacaatttgatagattgggccaagcctttc
ctaccaaataaaaagaagttgaaaaaaataatagatccaaggctgcaaaatcaataccct
tcaaaaggtgcatctcaaatagcagaactcatacttaggtgtctcgagtcagaccagaaa
tgcaggccagacatggaagacgttttgaagagtttggaacaaattaatacaatcaaaatg
aaattgagagagtcaaattccgaaggtagacacaaaaagcagcacgcgactgaccatcac
ggccggtctcctcatttgacttaccggtag

DBGET integrated database retrieval system