KEGG   Olea europaea var. sylvestris (wild olive): 111383892Help
Entry
111383892         CDS       T05244                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00520  Amino sugar and nucleotide sugar metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    111383892
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     111383892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind Sacchrp_dh_NADP KR NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 111383892
NCBI-ProteinID: XP_022863845
Position
Unknown
AA seq 345 aa AA seqDB search
MAKEASNGQNHVTTKPPPEPSPLRKAKFFQANMRILVTGGAGFIGSHLVDKLMQNEKNEV
IVVDNYFTGSKDNLSQWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKT
IKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDETYWGNVNPIGVRSCYDEGK
RVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRDEPLTVQLPGTQ
TRSFCYVSDMVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKEMINPEVKIITVENTP
DDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEDDFRKRIGIPRK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaagcatctaatggacagaaccatgtaactacaaagccacctccagagcca
tcgccattgcgaaaagcaaaattttttcaggcaaacatgagaatccttgttactggtggc
gccggattcattggctctcacttagttgataaactgatgcaaaatgagaagaatgaggtt
attgttgttgataactattttactggctcaaaggacaatttgtctcagtggattggtcat
ccaagatttgagcttattcggcatgatgtcacagagccattgttgattgaagttgatcag
atataccatcttgcatgtcctgcttccccaattttttacaaatataaccctgtgaagaca
ataaagacaaatgtgattggtactctcaacatgttaggccttgccaagcgagtaggagca
aggattttgctgacatcaacatctgaggtttatggagatccacttgtgcatcctcaggat
gaaacctactggggcaatgtcaatcctataggggtcaggagctgctatgatgagggaaaa
agagttgctgaaactttgatgtttgattatcataggcagcacggaattgaaatacgtatt
gcgaggatcttcaacacttatggaccccgcatgaatattgatgatggtcgagttgtcagc
aattttatagctcaagcaattcgtgatgagcctttgacagtccagttgcctggaacacaa
acaagaagcttttgttacgtctctgacatggttgatggccttattcgactaatggaagga
gaaaatactgggccaatcaacattgggaatccaggtgaatttacaatgctggagcttgct
gagactgtgaaggagatgatcaacccagaagtgaaaatcattactgtggagaatactcca
gacgatcctcgccagagaaaaccagatataaccaaggcaaaggagttgcttggttgggaa
ccaaaggttaagttgcgtgacggccttcccctcatggaggatgatttccgcaagaggatt
ggaatcccgaggaagtga

DBGET integrated database retrieval system