KEGG   Olea europaea var. sylvestris (wild olive): 111385527Help
Entry
111385527         CDS       T05244                                 

Definition
(RefSeq) probable glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00480  Glutathione metabolism
oeu00590  Arachidonic acid metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111385527
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111385527
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111385527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF1573
Motif
Other DBs
NCBI-GeneID: 111385527
NCBI-ProteinID: XP_022865692
Position
Unknown
AA seq 205 aa AA seqDB search
MHTEAHGNMHWGSLINRASLVFLGLALLLYYRHLPAKNIAQESPNSIYEFTVKDVRGNDV
PLTNYQGKVLLIVNVASKCGLTQSNYKELNILYEKNKDQGFEILAFPCNQFAWQEPGTNE
EIQEAVCTRFKAEFPIFEKVDVNGNNAAPLYKFLKSEKGGLLVDAIKWNFTKFLVNKEGK
VVERYGPRTPPLEIEKDIQDALGLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcacacagaggcacacggaaacatgcattgggggagtttgatcaaccgggcatctctt
gtctttcttggtcttgccttgttgttgtactacagacatcttcctgccaaaaatattgcc
caagaatccccaaattccatttatgaattcactgttaaggatgttcgtggaaatgatgtg
ccattgaccaattaccaagggaaggttcttctcattgtgaatgttgcttcaaaatgtggt
ttaacacagtcaaattacaaagagttaaatattttgtacgagaagaataaagaccaaggt
ttcgaaatattggcatttccttgcaatcagtttgcctggcaagaaccaggaactaatgag
gaaattcaagaagccgtttgcacaaggtttaaagcagaatttccaattttcgaaaaggtt
gatgttaatgggaataatgcagcccctctctacaagttcttaaaatcggaaaaaggcggt
ttgcttgtagatgctatcaagtggaattttactaagtttctggtgaacaaggaaggaaaa
gttgtggagagatatggtcctaggaccccacctcttgaaatcgagaaagacattcaagat
gctttgggcttatcttga

DBGET integrated database retrieval system