KEGG   Olea europaea var. sylvestris (wild olive): 111385574Help
Entry
111385574         CDS       T05244                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 8-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00061  Fatty acid biosynthesis
oeu00071  Fatty acid degradation
oeu01100  Metabolic pathways
oeu01212  Fatty acid metabolism
oeu04146  Peroxisome
Module
oeu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111385574
   00071 Fatty acid degradation
    111385574
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111385574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oeu01004]
    111385574
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oeu04147]
    111385574
Enzymes [BR:oeu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111385574
Lipid biosynthesis proteins [BR:oeu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111385574
Exosome [BR:oeu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111385574
  Exosomal proteins of breast cancer cells
   111385574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 111385574
NCBI-ProteinID: XP_022865747
Position
Unknown
AA seq 520 aa AA seqDB search
MMGDSERRILSTNMNENLGDSNSSSILKVYGSYGIVGAVIVAIAIPILLSILMGKRKSKQ
RGVPVQVGGEVGLAMRNARSVKLVEVPWEGATTMAALFEQSCKKHSQERCIGMRKVTSKE
FVTANDGRKFEKLHLGEYQWETYGQVFDRACNFASGIVKLGHDVDTRAAIFADTRPEWLI
AFQGCFRQNITVVTIYASLGDDAVIHSLNETQVPTLVCESKQLKKLAAISSSLKTIRNVI
YFDDEETSSSSSVNQDMDNWRISSFSEVEKLGRDSSVQPRLPIKTDIAVIMYTSGSTGLP
KGVMITHGNIVATAAAVMTVIPRMGSKDVYLAYLPLAHVFELAAETVMLTAGAAIGYGST
LTLTDTSNKIKKGTKGDASALKPTLMAAVPAILDRVRDGVLKKVDEKGGFSKKLFNIAYS
RRLAAIGGSWFGAWGLETFLWDIIIFKKIRSILGGEIRFMLCGGAPLSGDTQRFINICMG
APIGQGYGLTETCAGATFSESDDTSVGRVGPPLPCCYIKV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagactccgagagaagaattttgagcacgaacatgaatgagaatctgggagat
agtaattcctcttcaattctgaaagtttacggatcatatggcatagttggtgcggttatt
gttgccatagctatacccatacttctttccatactaatgggaaaaagaaaatcaaaacag
agaggagttccagttcaagttggcggtgaggttggtttggcaatgcgcaatgctagatcg
gtcaaattagttgaggttccttgggaaggggccactactatggctgctttatttgagcag
tcatgtaagaaacattcccaggaaaggtgtattgggatgagaaaagtaactagtaaggag
tttgttacagctaacgatgggaggaaatttgaaaagcttcacttgggtgagtaccagtgg
gaaacttatggacaagtatttgatcgtgcatgcaactttgcttctggtattgttaaacta
ggtcatgatgtggatacccgtgctgccatttttgccgatactcggccagaatggttgatt
gcattccagggctgcttccgtcaaaatatcactgttgtcaccatttatgcttctttagga
gatgacgctgtaatacactcgctaaatgagactcaagtgccaaccttggtttgtgaatct
aagcaattgaagaagttggctgccataagttcaagcctgaaaactattagaaatgtcata
tactttgatgatgaagaaacttcgagtagttccagtgttaaccaagatatggataattgg
agaatttcctctttttcagaagtggaaaaacttggtagagatagttctgttcaacctaga
cttccaatcaagacagatattgctgtcatcatgtatacaagtggcagtacaggcctccca
aagggtgttatgataactcatggcaacattgtggccactgcagctgcagttatgacagtg
atccctcgaatgggaagcaaggatgtttatttggcatatttgcctctagctcatgtattt
gaattagctgctgagaccgtgatgctaactgctggtgctgcaattggctatgggtcaaca
ttgacattaacagacacatccaataaaataaaaaaaggaactaagggagacgcttccgca
ttaaagcctactctaatggcagctgttccagctattctagaccgtgttcgagatggagtt
ttgaagaaggttgatgagaaaggaggtttttctaagaagcttttcaacatcgcctattct
cggcgactggcagctattggagggagctggtttggggcatggggattagagacattcttg
tgggatataattatttttaagaagatacggtctattcttggaggagaaattcgattcatg
ctttgtggcggagctcctttatctggagatacacaaagattcatcaacatctgtatgggg
gcccctattggtcaaggatatggtctgacagaaacatgtgctggtgctactttctctgag
tcggatgacacatctgttgggcgtgttggtcctcctcttccttgttgctatatcaaggta
tga

DBGET integrated database retrieval system