KEGG   Olea europaea var. sylvestris (wild olive): 111385780Help
Entry
111385780         CDS       T05244                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00052  Galactose metabolism
oeu00500  Starch and sucrose metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111385780
   00500 Starch and sucrose metabolism
    111385780
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111385780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111385780
NCBI-ProteinID: XP_022865962
Position
Unknown
AA seq 663 aa AA seqDB search
MAAYSFTRPQYDLENAASYTPIPDRPASASSTPAGHWRSKKLLAGILFSSVFLLSLILLF
VNQQSESQTKVNGTNQGKSSTPKPISPTARTAPPSRGVSQGVSEKTFPLASGENATYTWT
NAILSWQRTAYHFQPENNWMNDPNGPLFHKGWYHLFYQYNPDSAVWGNITWGHAVSKDLI
HWLHLPFAMVPDHWYDINGVWTGSATILPDGQIVMLYTGDTYDVKQVQCLAYPANLSDPL
LLDWVKYSGNPVLVPPPGIGAKDFRDPTTAWLSPDGDKWRITIGSKVNTTGISLVYETVD
FKTYDMLDGYMHAVPGTGMWECVDFYPVSMSEINGLDTSVSGSGVKHVLKASLDDDKNDY
YALGVYDPIEDKWIPDDPKLDVGIGLRYDYGKYYASKTFYDQNKQRRILWGWIRETDSEY
ADILKGWASVQSIPRTVMFDQKTGSNILQWPVSEVEELRSEIVEFDNVKLGPGSIVPLKV
DTPSQLDIVASFEIDEDAFEGTVEADADADAGYSCPTSGGAANRGELGPFGVIVLGDKTL
SEGTPIYFYVTKGTNGKFETHFCADELRSSLAPDVDKVVYGSKVPVLHGEKYSLRSLVDH
SIVESFAQGGRTVITSRVYPTRAVDGAARVYLFNNATKVSVTASVKMWNMGSADIRTFPL
NEQ
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctactctttcacgaggccacagtatgatcttgaaaacgccgcctcctacact
cccatccctgaccgaccagcatccgcctcctccactccggccggtcattggagatccaag
aagcttctcgccggcattctcttttcctctgtattcttactttccttaattcttctgttt
gttaaccaacaatccgaatcccaaaccaaagtcaatggcaccaatcaaggaaaatcttca
actcccaaacccatatcgccgacagctcgaactgcgccgccgtcaagaggggtgtcccag
ggtgtgtcggagaagactttcccgctagccagcggtgaaaatgcaacctacacgtggacc
aatgctatactgtcttggcaacgaactgcttaccattttcaaccagaaaataattggatg
aacgatccaaacggtccattatttcacaagggatggtaccatttgttctatcaatataat
ccagattcagctgtatggggaaatatcacatggggccatgcagtatcaaaggatcttatt
cactggctccacttaccatttgcaatggtccctgatcactggtatgatatcaatggagtc
tggaccgggtccgccacaattcttcctgacggtcagattgtgatgctttacactggagat
acatatgatgttaagcaggtgcagtgtttagcttatcccgccaacctatctgatcctctc
ctgcttgattgggtcaagtattcgggtaatccggttctggttcccccacccggtattgga
gcaaaggactttagagacccgactaccgcttggcttagcccggatggtgataaatggcgg
atcacgattggatccaaggttaatacaacgggtatttcacttgtgtatgagacggtagat
tttaaaacttatgatatgttagatgggtatatgcatgcagttccgggtacgggtatgtgg
gagtgtgtggacttttacccagtttcgatgagtgagataaacggtttggacacgtcggta
agcgggtcgggtgttaagcatgtgctgaaagcaagtttggatgatgacaagaatgattat
tatgcacttggggtctacgatccaattgaggataagtggataccggatgacccaaaattg
gatgttggaatcgggttaagatatgattatggtaaatattatgcttccaagacattttat
gatcagaataagcagaggagaattttgtggggttggattagagaaactgatagtgaatat
gctgacattttgaagggatgggcatctgttcagtcgattcctaggactgtcatgttcgat
cagaagacggggagtaatatacttcaatggccagtcagcgaagtggaagaattgagatca
gaaatcgttgagtttgataatgtaaagcttggaccgggatccattgttccgcttaaagtt
gacacaccttctcagttggacatagttgcctcatttgaaattgatgaggatgcatttgaa
ggaacagttgaagctgatgctgatgctgatgctggttacagttgccctacaagtggtggt
gctgctaataggggggagttgggaccttttggtgttattgttcttggcgataaaactcta
tcagagggaacccctatctacttctacgttaccaaagggactaatggaaagtttgaaact
catttttgtgcagatgaattaagatcatctctggctcctgatgttgacaaagtagtctat
gggagcaaagtccctgttcttcatggcgaaaaatactccctgagatcactggtcgatcac
tccatagtggagagcttcgctcaaggaggcagaacagttataacgtcgcgagtttatcca
acaagggctgttgatggagcagcacgagtttacttgtttaacaatgctactaaagtgagt
gtcacagcatctgtgaagatgtggaacatgggttctgctgatattcgtaccttcccctta
aatgagcagtga

DBGET integrated database retrieval system