KEGG   Olea europaea var. sylvestris (wild olive): 111386126
Entry
111386126         CDS       T05244                                 

Definition
(RefSeq) cytochrome P450 76A1-like
  KO
K20618  nepetalactol monooxygenase [EC:1.14.14.161]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00902  Monoterpenoid biosynthesis
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    111386126
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:oeu00199]
    111386126
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.161  nepetalactol monooxygenase
     111386126
Cytochrome P450 [BR:oeu00199]
 Cytochrome P450, plant type
  CYP76 family
   111386126
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111386126
NCBI-ProteinID: XP_022866331
Position
Unknown
AA seq 512 aa
MEWALSSVNPLTIALTAGFVLLILSFLKGKKSGNKPPGPKGIPIFGSMFQLGDLPHQTMY
HWSKTYGPLLWLNLGQVNTMIVQNASTAAELFKKHDVPFADRKVPDALTAYNFNAGSLGM
NTFGGHWRVLRRLCSMEFLVNKRMNETTELRMRLMHDMIRWIEEDSRTSLAQGGTGAVQL
SRFLFLMAFNLVGNLMLSRDLLDAKDPEGKEFFDCMNVILELAGTPNIADFFPALKLIDP
LGMKRNMTRNMTRTMKISSKFVQERLDNRKAGKFQEKKDFLDVLLEYEGDGKDGPDRMTE
HNVNIVIMEMFFAGSETTSISIEWGFTELLRNPHAFKKVREELDRVVGVNRLVEEKDVEN
MPYLQAVVKETLRLHPALPLLLPRNTMEDTKYMGYLIPKGTQVLVNAWAIGRDPDSWEDP
LSFKPERFLKSSIEYKGQHFELIPFGSGRRICVGFPLAHRVVHLTIATLVQAFDWDLGTG
VKPEHIDLQERLGLTLRKKNPLKVIPKKRVQV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggagtgggctttgagttcagttaatccactcactattgctcttacagctggttttgtt
cttctgattctgagttttttgaagggcaagaaatcaggaaataaaccaccggggcctaaa
ggaatcccaatttttgggagtatgtttcagttgggagatttgcctcaccaaaccatgtac
cattggagcaaaacgtatggacctctcctttggctcaatctcggccaggttaatacgatg
atcgttcagaatgcctctacggctgctgagttgttcaagaaacacgacgtgccgtttgct
gaccgcaaggtgcctgatgcactcacggcgtataatttcaacgcgggatctttggggatg
aacacgtttggaggacactggagggtactccggcggctttgttccatggagttcttggtg
aacaagagaatgaacgagacaactgagttgagaatgaggcttatgcacgatatgatacgc
tggattgaagaggactcgagaacgtcactagctcaaggaggaactggggcagtgcaactg
agccggttcctcttccttatggcgtttaacctggtggggaacctgatgttgtccagggat
ttgttggatgcaaaggatcctgaagggaaggagttctttgattgtatgaatgttattctt
gagctcgcaggaacgccaaatatagctgatttctttccagctttgaagttgatcgatccc
cttgggatgaagaggaatatgacgaggaacatgaccagaaccatgaaaatttcttctaag
ttcgtgcaggagagactcgacaacaggaaggcaggcaaattccaggaaaagaaagacttt
cttgatgtgttattggagtatgaaggtgatggcaaggacgggcctgataggatgacagag
cacaatgtcaacattgttatcatggaaatgttcttcgctggatctgagactacaagtata
agcatcgaatggggtttcacagagctactacgcaacccacacgcgttcaagaaggttaga
gaggagctcgacagggtggtcggagtaaacaggctggtggaagagaaagacgtcgagaac
atgccatatctccaggcagttgtgaaggaaactctccgattgcatcctgcactacccttg
ctcctgccaaggaacacaatggaggacaccaagtacatggggtaccttatcccaaagggc
acccaagttcttgtgaacgcttgggccattggaagagatccagattcctgggaggatcca
ttgagtttcaagcccgaaaggttcttgaaatcaagcattgagtacaagggacaacatttt
gagttgatcccatttggttcaggaagaaggatttgtgtagggttccccttggctcatagg
gtggttcatctcaccatagcgaccctggtccaggctttcgactgggatcttgggacaggt
gtcaaacccgaacacattgacctgcaagagaggttgggattaactctgaggaagaagaat
ccactcaaggtcatacccaagaaaagagtacaagtctaa

DBGET integrated database retrieval system