KEGG   Olea europaea var. sylvestris (wild olive): 111386866Help
Entry
111386866         CDS       T05244                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111386866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Zds_C
Motif
Other DBs
NCBI-GeneID: 111386866
NCBI-ProteinID: XP_022867120
Position
Unknown
AA seq 112 aa AA seqDB search
MGTQGYAAPEYIATGHLTEKCDVYGFGIVLLELLSGRRVIDRSTSKEQFLVDWARPYLSE
EKEVYRVVDTKLKGQYPLEGAVIVSNLVLQCISSNPKSRPRMSEVLATLEQL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggtacacaaggctacgctgcaccggaatacattgctacaggccatttgacggaaaag
tgtgatgtatatggctttgggattgttctgctggaattactatctggccgtcgggttatt
gatagatctaccagtaaagaacaattcctggtggattgggcaagaccatatttgtccgag
gagaaagaagtgtatcgagtagtggacaccaaattgaagggccagtaccctctggaagga
gcagttattgtttcaaatcttgttttgcagtgcataagtagtaatcccaaaagcaggcca
cgtatgtcggaggttttagccacattggaacaactctga

DBGET integrated database retrieval system