KEGG   Olea europaea var. sylvestris (wild olive): 111387361Help
Entry
111387361         CDS       T05244                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00906  Carotenoid biosynthesis
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Module
oeu_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    111387361
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     111387361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 111387361
NCBI-ProteinID: XP_022867685
Position
Unknown
AA seq 124 aa AA seqDB search
MSIYRYVYAAVGDPMPKISGVVKLDVSVSESNRCDCIVASRLYGEGCFGGEPFFVAKEPN
NPSADEDDGYVVSYVHNEKTGESRFLVMDAKSPNLDIVAAVELPRRVPYGFHGLFVSEND
LNKL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatataggtatgtgtatgcagcagtaggagatccaatgccaaaaatatcgggg
gtggtgaagcttgacgtatcggtgtctgaatccaatcgttgtgactgcatcgtggcgagt
cggctttatggagaaggttgctttggtggtgaaccattttttgtggcgaaagagcctaac
aatccaagtgcagatgaagatgatggttatgtggtgagttatgtgcataatgagaagact
ggagaatcaagattcttggttatggatgccaaatccccaaatcttgatattgtggctgct
gttgagcttccaaggagggtgccttatggcttccatgggctctttgtcagtgaaaatgac
ctcaacaagctatga

DBGET integrated database retrieval system