KEGG   Olea europaea var. sylvestris (wild olive): 111388075Help
Entry
111388075         CDS       T05244                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111388075
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111388075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 111388075
NCBI-ProteinID: XP_022868506
Position
Unknown
AA seq 500 aa AA seqDB search
MTWLRNFNQLSANFSRQPSVKPTFTPPSLTRLLQFSTESQSPATVGNSANKYAGLGPTKG
DEKPRVVVLGSGWAGCRLIKDIDTKIYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEP
IGRIQPAISREPGSYFFLSNCTRADFQNQEVHCQTVIDGVDTLNPWGFKISYDKLVIAAG
AEASTFGIKGAKEHAIFLREVHHAQEIRRKLLLNLMLSDVPGVTDEEKRRLLHCVVVGGG
PTGVEFSGELSDFIMKDVRQRYAHVKDYIRVTLVEANEILSSFDDRLRTYAIKQLTKSGV
HLVRGIVKDVQPRKIILSDGTDIPYGLLVWSTGVGPSPFVKSLDIPKAPGGRIGINEWLQ
VPSVQDVFAIGDCSGFLESTGKPVLPALAQVAERQGKYLAKLLNRIGKAGGGHANAAKEM
DFGAPFVYRHLGSMATVGRYKALVDLRKSKEEKGLSLAGFTSWFIWRSAYLTRVISWRNR
FYVAINWLTTFVFGRDISRI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacctggttgagaaatttcaaccagttgtccgccaatttctcaaggcaaccatcagtt
aaaccaacatttacgccaccatcactcactcgattattgcaattcagcactgagtctcag
tctccggcgactgttggtaattccgccaataaatatgctgggttggggcccaccaagggg
gacgaaaagccgagggtggtggttttgggttcgggatgggccgggtgcaggcttattaag
gacatcgacaccaagatctacgatgtcgtttgtgtatccccaagaaatcacatggtgttt
actcctctattagcttccacttgcgttggcactctcgagttccggtctgttgccgaaccc
attgggaggatccagcctgcaatttctcgtgagcctggttcttatttctttctttctaac
tgtacccgggcagattttcagaaccaagaggttcattgtcaaactgtgattgatggggtg
gataccttaaatccttggggcttcaaaatctcatatgataagttagtaattgctgctgga
gcagaagcttctacatttggaattaagggtgcaaaagaacatgcaatttttctccgtgaa
gttcatcatgctcaagaaatcaggaggaaactactactaaaccttatgttgtctgatgtg
cccggagttactgacgaagaaaagcgtaggctcctgcactgtgttgttgttggaggtggt
cctactggggtcgagttcagtggagaacttagtgactttattatgaaggatgttcgtcaa
agatatgcacatgtgaaagattatattcgtgttactttggttgaggccaatgagatatta
tcgtcatttgatgatcgcctaagaacatatgcaattaaacaattaaccaagtcaggagtt
catcttgtccgtggaattgtgaaggatgtccaacctcgaaagattattcttagtgatggc
acagatattccatatggtctcttagtgtggtctacaggggttggcccctcaccatttgtc
aaatctctcgatattcccaaagcacctggtggaaggattggaattaatgaatggttacaa
gtcccttctgtacaagatgtgtttgcaattggtgactgcagtgggtttcttgaaagtaca
ggcaagcctgttcttccagctcttgcccaggttgcagagcggcaggggaaatatctggcg
aaattgttgaaccgtataggaaaagcaggtggagggcatgcaaatgctgcaaaagaaatg
gactttggggctccatttgtctataggcacttgggaagcatggcaaccgttgggagatac
aaggcccttgtggatcttaggaagagcaaggaggaaaagggtctatcactagcaggattt
actagttggtttatttggcgctcagcttatcttactcgggtcataagctggaggaacaga
ttctatgtggctatcaactggttgacaacttttgttttcggtcgtgatataagccggata
tag

DBGET integrated database retrieval system