KEGG   Olea europaea var. sylvestris (wild olive): 111388946Help
Entry
111388946         CDS       T05244                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A isoform X1
  KO
K03254  translation initiation factor 3 subunit A
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111388946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:oeu03012]
    111388946
Translation factors [BR:oeu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111388946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 111388946
NCBI-ProteinID: XP_022869547
Position
Unknown
AA seq 971 aa AA seqDB search
MATFARPENALKRAEELINVGQKQEALEALHSFITSRRYRAWTKTHEKILFKYVDLCVDL
RRGRHAKDGLIQYRSICQQVNINSLEEVIKHFMQLATERAELARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRSVLEILRNNSRLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLAAPESLQLYLDTRFEQLKI
ATELELWQEAFRSIEDIHGLMCMVKKTPKPSLMVVYYAKQSEIFWISSNHIYHAYCWLKL
FSLQKSFNKNLSQKDLQLIASSVVLAALSVPPFDQSYGASHMELENEKERRLRVASLIAF
DVEPKPENREVLSRASLFSELASKGVMTCVTQEVKDLYNILEHEFLPLDLAIKAQPLLTK
ISKLGGKLSSASSVPEVRLSSSVPEVRLSQYVPALEKLANLRLLQQVSQVYQTMNIDNLS
RIIPFFDFSIVEKISVDAVKHNFLTMKMNYMKGSIIFGNKNVESEGLRDHLATFAESVSR
ARIMIYPPVKSTSKLGETLSDLVEVVEKEHKRLLARKSIIEKRKEEQERQHFEMEREEEA
KRQKLQKITEEAEQRRLASEFEQMKNQRILREIEERELEEAQALLLEAEKRRTKRGKKPV
LEGEKITKQHLMELALTEQLRERQEMEKKIQKLAKTLDYFERAKRDEAAPLIEAAYQLRL
AEEEALHEREQKLEIELSRQRHAGDLEEKRRLSRMLENKRLFQASVVSRRETEFNRIQSE
REERINQIIQSRKQEREAKRKMIYYLRSEEERQKRLLEEEEARKREEMERKKKEEAERKA
KLDEIAEKQRQRERELEEKERQRREELLGRSNAVPARHTVPSTMAHPAEAAPVAPASAAA
SPAKYVPRFKRTSAEAGVPAPPPETDKWTSGRSSDDQTSQQNDRWRDDRRSAFGGGGGGG
PRSTWSSRNRG
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttttgccagacctgagaatgctttgaagagagctgaagagttgattaatgtt
ggacaaaagcaagaggcccttgaagctcttcatagttttattacctcaaggaggtacaga
gcatggacaaagacgcacgagaagatactgttcaagtatgtggacctatgtgttgacttg
agaaggggaaggcatgctaaggatggtcttattcagtatcgtagtatctgccaacaagtt
aacatcaattccctggaggaggtgataaaacatttcatgcagttggccactgaaagagct
gagcttgcacgtagtcaggcacaggccttagaagaagctctggatgtggatgacttagaa
gctgataagagacctgaagatcttatgttgagttatgttagtggggagaaaggaaaagac
agatctgaccgcgagctcgtcacgccatggtttaagtttttgtgggagacataccgaagc
gtactggaaattttgcgcaacaactcaagactagaggctctgtatgctatgactgcacac
cgtgccttccagttctgtaagcaatacaaacgaactacagaatttcggcgcttgtgtgaa
atcatcaggaatcatcttgcaaatcttaacaagtacagagatcagagagataggcctgat
cttgctgctccagaaagcctgcagttatatctggataccagatttgagcaactgaaaatt
gctactgaacttgaactttggcaggaagcgtttcgttctattgaagatatacatggattg
atgtgcatggttaagaaaacacccaaaccttccttgatggtggtttattatgccaagcaa
tcagaaatattctggatatcttcaaaccatatttatcatgcttattgctggcttaagctt
ttctcacttcagaaaagcttcaataagaacttaagccagaaggatttgcagctgatagca
tcatcggttgttttagctgctctttcagtgcctccttttgatcaatcatatggcgcgtcc
catatggagcttgaaaatgaaaaagagcggcgtttgagggtagccagccttattgcattt
gatgttgaacccaaacctgagaacagagaagtgctttcaagggcatcacttttctcagaa
ttggcatccaaaggtgtaatgacgtgtgttactcaggaagtgaaagatctatataacatt
ctggaacatgagtttctccctttagacctggctattaaagcacagcccttgttaacaaaa
atatcaaagctagggggtaagctttcgtctgcttcttctgttccagaagtgcgattgtct
tcttctgttccagaagtgcgattgtctcaatatgttcctgctctggaaaagcttgctaat
ttgaggctgctgcagcaggtttcacaggtgtaccagactatgaatattgataacttatct
aggataatccctttctttgatttttctattgtggagaagatatctgtggatgctgttaag
cataattttttaaccatgaaaatgaactatatgaaaggctccatcatctttggtaacaag
aatgttgaatcagagggtctacgagatcacctggccacttttgcagagtccgttagtagg
gcaaggatcatgatctaccctcctgtaaaaagtacttcaaaattaggggaaacactttca
gatcttgtggaggttgtggaaaaagaacacaagagacttcttgcacggaagtccattata
gaaaaacgcaaagaagagcaggaacgccaacattttgagatggaacgagaggaggaggca
aagaggcaaaaactacagaagattactgaagaggcagaacagagaaggcttgcctctgag
ttcgaacaaatgaagaatcaaagaattctaagagaaatagaggagcgtgaactggaagaa
gcccaagcattgttgctagaagctgaaaaacgtcgcacgaagagagggaagaaaccagtt
ctagaaggagaaaaaataactaagcagcatttaatggaactagccctgaccgagcaacta
agggagaggcaagaaatggagaaaaaaatacagaagcttgccaaaacattggattatttt
gagagggcaaaaagagatgaggcagcgccacttattgaagcagcatatcaactccgtttg
gcagaggaggaagctcttcatgaacgtgagcaaaagctagagattgagctaagcagacaa
cgacatgctggggacctggaggagaaaaggaggctatcccgaatgttggagaacaagaga
ttattccaagcaagtgttgttagtcgtagggaaactgaattcaacagaattcagtcggag
agagaagagagaatcaaccaaatcatccagtcaagaaagcaggagagggaggctaagagg
aaaatgatatattatctgaggtccgaggaggaaagacaaaaaagactgcttgaagaggag
gaagcgcggaagcgtgaagagatggaaagaaagaaaaaagaggaagctgaacgaaaagcc
aaattggacgagattgctgaaaagcaaaggcaaagagagcgggaactggaggaaaaagaa
agacagcgtagagaggaactcttggggagatcaaatgctgtgcctgcaaggcacactgtg
ccttctactatggcacatccagcagaggcagcacctgtggcgccagcttctgctgcggca
tcaccagcgaagtacgtgcccaggttcaaaaggacgtctgctgaggctggggtcccggct
ccacctcctgaaactgataaatggaccagcggccgcagttcagacgatcaaacatctcaa
caaaatgacaggtggagggatgatcgtagatctgcctttggtggtggtggtggtggtggc
ccgaggtccacttggtcatctagaaatcgtgggtga

DBGET integrated database retrieval system