KEGG   Olea europaea var. sylvestris (wild olive): 111389011Help
Entry
111389011         CDS       T05244                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111389011
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111389011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 DAO EF-hand_8 ATP-cone Toxin_35
Motif
Other DBs
NCBI-GeneID: 111389011
NCBI-ProteinID: XP_022869623
Position
Unknown
AA seq 604 aa AA seqDB search
DKNLCTSNKKECSHKYDCSVYKMNEDDNNVRSSLVSFISCILSPLKLNSAGFNSSGGLIA
HADSPSEGGKSIFELNQKVPQKKKVVVLGTGWAGTSFLKDLDISSYDVQVVSPRNYFAFT
PLLPSVTCGTVEARSIVEPVRNIIKKRNGEINFWEAECLKIDQANRKIFCRSIIDENLAG
NNEFSLQYDYLIIAIGAQVNTFNTSGVLEHCHFLKEVEDAQKIRRTVIDCFEKAVLPGLT
EEERKTNLHFVVVGGGPTGIEFAAELHDFVHEDLVNIYPSVKDLVNITVIQSGDHILNSF
DERISSFAERKFQRDGIQVLTGHRVVSVSDRLINMKNKTTGNDDSMPHGMVVWSTGVGTH
PVVKDFMEQVGQGNRRVLATDEWLRVKGCENVYALGDCATVDQKKIMEDISEIFKAADKD
NSGTLTIEEFQDVIEDVIIRYPQVELYLKSKHLVDVADLLRDTDGNDRLEVDIEGFKLAL
SHVDTQMKSLLATAQVAAQQGAYLSRCFNIWEKCKDNPEGPRKFRSGGRHEFRPFRYRHL
GQFAPLGGEQAAAELPGDWVSMGHSTQWLWYSVYASKQVSWRTRFLVIGDWSRRYIFGRD
SSRI
NT seq 1816 nt NT seq  +upstreamnt  +downstreamnt
tgataagaatctgtgtactagtaataagaaggaatgctcccacaagtatgattgtagtgt
ttataagatgaatgaagatgacaataacgtgagaagttcattagtttcatttatatcttg
cattttatctccattgaaattgaattctgctgggtttaacagtagtggagggctcattgc
tcatgcggactccccttcagaaggtggaaaatcaattttcgaactcaatcaaaaggtacc
acagaagaaaaaggtggtggtactaggaacaggatgggctggtactagctttctgaagga
tttggatatttcttcctatgatgttcaggtggtttcacctaggaattactttgctttcac
ccctttgttaccgagtgttacatgtggaacagttgaggcacgaagtattgtagaacctgt
tcgaaacataataaagaagagaaatggggaaattaatttctgggaagcagaatgcctcaa
gattgatcaagcaaacagaaagattttctgtcggtccattatcgatgaaaatttagcagg
aaataatgaattctctctacaatatgattatttaattatagcaattggagcacaagtaaa
cacatttaacacttctggtgttttggagcattgccattttttgaaggaagtagaggatgc
tcaaaagatccgtaggactgtaatcgattgctttgaaaaagctgtccttccagggctgac
tgaagaagagcggaaaactaacctccactttgttgtagtcggagggggtccaactggcat
agaatttgcagcggaacttcatgactttgttcatgaagatttagtcaacatatatccatc
agtcaaagatttagtgaatataacagtaatacaatctggagatcacatcttgaactcgtt
cgatgaaaggatcagctcatttgctgaacggaagtttcaaagggatggtattcaagtttt
gacaggacaccgcgtagtgagtgtttctgatagattgattaatatgaagaacaaaactac
tggaaatgatgattcaatgccgcatgggatggtggtgtggtcaaccggtgttggcactca
tccagttgtcaaggattttatggaacaagttggacagggtaataggcgtgttctagcaac
tgatgaatggttgcgagtgaagggatgtgagaatgtgtatgcccttggtgattgtgccac
tgtcgatcaaaaaaaaatcatggaagatatctcggaaatatttaaagctgcagataaaga
taattctggcaccctaactattgaagaattccaagatgtaattgaagatgtcatcatcag
ataccctcaagtggagctgtatctgaagagcaagcatctagttgacgtagctgacttact
aagagatacagatggtaatgataggctggaggtagatattgaagggttcaaattagcact
atcgcatgttgatacacagatgaaaagtcttctagctactgcacaagttgcagctcaaca
aggtgcatatctatctaggtgctttaacatatgggagaaatgtaaagacaatccagaagg
ccctcgtaaattcagaagtggcggccgtcatgaatttcgtccttttcggtaccgacatct
tgggcagtttgcaccacttggaggggaacaagcagcagcagaactgcctggagactgggt
ttccatgggtcatagtacacagtggctttggtattctgtgtatgcaagcaagcaagttag
ctggcgcacaaggttcctagtaataggtgattggtcaagaagatacatctttgggagaga
ttcaagtcgtatctga

DBGET integrated database retrieval system