KEGG   Olea europaea var. sylvestris (wild olive): 111390935Help
Entry
111390935         CDS       T05244                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00010  Glycolysis / Gluconeogenesis
oeu00562  Inositol phosphate metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111390935
   00562 Inositol phosphate metabolism
    111390935
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111390935
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111390935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111390935
NCBI-ProteinID: XP_022871826
Position
Unknown
AA seq 507 aa AA seqDB search
MSFQKLSVLIFLFFIVKINSNAEENFDVRQHLCTVTRYHVAKDISENSFVPSNINDQCTP
IHLNLVARHGTRAPTKKKLKQLEALSTRLQFLLQNVEEEKKSLHNIPAWLSGWKSPWKGK
HKGGELISEGEAEMYELGIRIREKFPELFKEEYHPDIYPIKTTQISRASASAVAFGMGLF
SGRGNLGLGRHRAFAVTSESRASDIMLRFHDCCQNYKAFRKSQEPFVDKLNKPLLNEIAQ
ELAKRWSLNFTTQDISSLWFLCKQEASLLNTTDRACALFSPSQVDLLEWADDLELFILKG
YGNSLNYRMGVPLLEDVIQSMEKAINAREEGLVPGSYEMARLRFAHAETLLPFSCLIGLF
LDGSEFELILREHPLQLPPKPPQKRIWHGSTVVPFAGNNMLVLYSCPDNNSSKYFVQVLH
NEHPIRLPGCENSDVCPFEVFKERIAAPHLKHDYTALCNMESDQTEQTASRFLLTGYSLS
KITSYTTVVGAICTLFLAYLFIAFVKF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccagaagctatcagttttaatattcttattttttatagtgaaaataaattcg
aatgctgaagaaaacttcgatgttcgccaacatttatgcactgtgaccaggtatcacgtt
gccaaagatatttctgagaattcgtttgtgccctcgaatatcaatgatcaatgtacacct
attcacctaaatcttgtggcaagacatggaacacgtgcccctaccaagaaaaagttgaag
caattagaagccttgtctacccggctacaattccttttgcaaaatgtagaagaggagaag
aaatctttacacaatattcctgcgtggttatcgggatggaaatctccttggaaagggaag
cacaagggtggagagttaatcagtgaaggagaagctgaaatgtacgagcttgggattaga
atcagagaaaaatttccagagctgtttaaagaagaataccacccagacatatatccaata
aaaactactcagatctctcgagcctcagctagtgctgtggcatttggtatggggctgttt
agtgggagaggaaatctgggattagggcgtcatcgagcttttgcagttaccagcgaaagc
cgtgcaagtgatataatgttgagattccacgattgttgtcaaaactacaaggcttttagg
aaaagtcaagaaccatttgttgataagctcaacaagcccttactaaatgaaattgcacaa
gaactagcgaagcgctggagtctgaattttacaacacaggatatatcatctctatggttt
ctgtgcaaacaggaagcgtccttattgaacacaactgatcgagcttgtgctctgtttagt
ccatctcaggttgatttgttggagtgggcagatgatctggagttattcatactgaagggc
tatggtaattcactaaactaccggatgggagtgccattgcttgaagatgtcatccagtcg
atggagaaagctattaatgctagagaagaaggacttgttcccgggagctacgaaatggcc
agactacgctttgctcatgctgaaactctacttccattttcatgtttaattgggctgttt
cttgatggatctgagtttgaactaatactaagagaacatcctttgcaactccctccgaag
cctccccaaaagagaatttggcatggcagcacggttgttccttttgctggaaataacatg
ctagttttatatagctgcccagacaacaattcgagcaaatactttgtgcaagtattgcac
aatgaacatcccattcgattgccgggttgtgaaaactctgatgtttgcccttttgaagta
ttcaaggaacgaatagctgctcctcatttaaagcacgactacacggctctttgcaatatg
gaatcagatcaaacggagcaaactgcctcgcggttccttctaacaggttacagtctgagc
aagatcacatcttatacaactgtcgtcggagctatttgtactctttttttggcataccta
tttatagcatttgtcaagttttaa

DBGET integrated database retrieval system