KEGG   Olea europaea var. sylvestris (wild olive): 111391236Help
Entry
111391236         CDS       T05244                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00630  Glyoxylate and dicarboxylate metabolism
oeu00710  Carbon fixation in photosynthetic organisms
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oeu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oeu_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111391236
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111391236
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111391236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 111391236
NCBI-ProteinID: XP_022872171
Position
Unknown
AA seq 182 aa AA seqDB search
MATSMISTSAVAAVNRAALAQANMVAPFTGLKSTSAFPVSRKNVDITSIANNGGRVSCMK
VWPPLGLKKFETLSYLPDLTREQLLKEVDYLLRMKWIPCLEFELEHGFVYRENHRSPGYY
DGRYWVMWKLPMYGCTDPVQVLNELDLCVKEYPNAFVRIIGFDNVRQVQCISFIAFKPPG
RA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcaatgatctccacctccgccgttgccgctgtcaaccgtgccgccctggct
caggccaacatggtggctcctttcaccggcctcaagtcgacttcggctttccccgttagc
cgcaagaatgttgacatcacgtccattgctaacaatggtggtagagtatcttgcatgaag
gtgtggccaccacttggtttgaaaaagtttgagactctttcgtaccttcccgatctcact
agggaacaactcctcaaggaagtcgattaccttctccgaatgaaatggattccttgcctc
gaattcgagttggagcacgggttcgtgtaccgtgagaaccacaggtctccgggatattac
gatggacgatactgggttatgtggaagctacccatgtatggatgtacggacccagtgcag
gtgttgaatgagttggacttgtgcgtcaaggaataccccaatgcctttgttaggatcatt
ggattcgacaacgtgcgtcaagtgcaatgcatcagtttcattgctttcaagccaccagga
cgcgcctaa

DBGET integrated database retrieval system