KEGG   Olea europaea var. sylvestris (wild olive): 111391634Help
Entry
111391634         CDS       T05244                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00450  Selenocompound metabolism
oeu00970  Aminoacyl-tRNA biosynthesis
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111391634
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111391634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oeu01007]
    111391634
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oeu03016]
    111391634
Enzymes [BR:oeu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111391634
Amino acid related enzymes [BR:oeu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111391634
Transfer RNA biogenesis [BR:oeu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111391634
 Prokaryotic type
   Other AARSs
    111391634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 111391634
NCBI-ProteinID: XP_022872654
Position
Unknown
AA seq 632 aa AA seqDB search
MACRVQHSMQNSLWFLSSSRFYSTIQSQNVRSKNPKYFCKKLLSSSSFSKGVRHCSATAS
YTDANINHSNAESFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLRKKVIFITGTDE
HGEKIAGAAAANGSSPREHCDSVSQAYKLLWRDLDIAYDKFIRTTDSKHEALVKEFYSKV
LANGDIYRADYEGLYCVNCEEYKDEKELLENNCCPMHLKPCVRRKEDNYFFALSKYQKRL
EDTLTENPDFVQPSFRLNEVQGWIKSGLRDFSISRASVDWGIAVPNDDKQTIYVWFDALL
GYISALLDDKEKPNLQTAISSGWPASLHLIGKDILRFHAVYWPAMLMSAGLSLPKMVFGH
GFLTKDGLKMGKSLGNTLEPTDLVHRFGSDAVRYFFLKEVEFGSDGDYSEDRFINIINAH
LANTIGNLLNRTLGLLKKNCQSTLATDSAIAAEGNALKDTVEKLVKFAYEKSHSSLLGKG
HAEKARKHYENLELSSACEAVLEIGNAGNVYIDGQAPWSLFKQGGSAFETAAKDLVIVLE
ALRIIAIALSPITPSLCLRIYTQLGYSEDQFNAVTWNDTKWGGLKCGQVMAQPNPVFGRI
ELETEAKNAGDSTNKASKKMNKTPKTQKAVEA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtagagttcaacactcgatgcaaaacagcctctggttcttatcatcttctcgt
ttctacagtacgatacaatcccaaaatgtccggtccaaaaatccaaagtatttttgcaag
aaattgctctcgtcttcttctttctcgaaaggagttcgccattgcagtgctactgcgagc
tatacagatgcaaatattaatcattcaaatgcagagtcatttgtactcaccactccactt
tattatgtaaatgcccctcctcacatgggcagcgcttacaccaccatagctgctgatgcc
attgctcgttttcagagacttctcaggaagaaggttatattcataaccggcacagatgaa
catggggaaaagatagctggcgctgcagctgccaatggttccagtccaagggagcactgt
gattctgtttcacaagcttacaagttactttggagagatttagacattgcttatgacaag
ttcattcgaacgactgactcaaaacatgaagccctagtgaaggaattctattctaaggtt
cttgccaatggtgatatctatcgggctgattacgagggattatactgtgtgaattgtgag
gaatacaaggatgagaaagaattgttggaaaataattgctgtcccatgcacttgaagcca
tgtgttcgaaggaaggaagacaattacttctttgccctatcaaagtatcaaaaaaggttg
gaagatactttgacagaaaacccggattttgtccagccgtcttttcgtttgaacgaggtg
caaggttggatcaaaagtggcctgagagatttctccatttcacgagcatcagtggactgg
ggcattgcagttcctaatgatgataaacaaactatttacgtatggtttgatgctttgttg
ggttatatatctgctctattggatgataaggagaaacctaatttacaaactgccatttct
tctggttggcctgcttctctacacttgattggcaaggatatattacgatttcatgctgtt
tattggccagcaatgctcatgtcagctggactgagcctaccgaagatggtttttggccat
ggattcttgacaaaggatggcttgaaaatgggaaagtcactgggaaatacacttgagccg
actgacttggtgcacagatttggctctgatgcagtcaggtacttctttctcaaggaggtg
gaattcggtagtgatggggactactcggaggaccgttttatcaatattattaatgcgcat
cttgcgaacacaattgggaatcttctgaaccgtacacttggacttttgaaaaagaattgc
caatcaactttggctactgattcagctattgcagcagaaggaaatgcattgaaggatacg
gtcgagaaactggtaaagtttgcatatgaaaaatctcactcttctttgttgggaaaggga
cacgccgagaaagccagaaaacattatgaaaacctagagttgtcatcagcttgtgaggca
gttctagagatcggtaatgctgggaatgtttatatcgatggacaagcaccatggtctctt
tttaagcaagggggttctgcctttgaaactgcagccaaggacctagtgattgtattggaa
gcattaaggatcatagcaattgctttgtccccaatcactccaagtttatgtttgagaata
tacacccagcttggttattctgaagaccagttcaatgctgttacttggaatgatacaaaa
tggggtgggctgaagtgcggtcaggtcatggcgcaaccaaatcctgtttttggtaggatt
gaacttgagactgaagcgaaaaatgcaggggattcgactaataaagcaagtaagaagatg
aacaagacgccgaagacccaaaaggcagttgaagcctag

DBGET integrated database retrieval system