KEGG   Olea europaea var. sylvestris (wild olive): 111393211Help
Entry
111393211         CDS       T05244                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111393211
   01009 Protein phosphatases and associated proteins [BR:oeu01009]
    111393211
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111393211
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: Other
  Wnk family
   111393211
Protein phosphatases and associated proteins [BR:oeu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111393211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pneumo_M2 OSR1_C
Motif
Other DBs
NCBI-GeneID: 111393211
NCBI-ProteinID: XP_022874403
Position
4
AA seq 621 aa AA seqDB search
MSRAQHTGESMDENGYAETDPTGRYGRFDEVLGKGAMKTVYKAIDEVLGMEVAWNQIHLN
HLLQSPEDLQRLYSEVHLLSTLNHKSIIKFYTSWIDVEQRTFNFITEMFTSGTLREYRAK
YKQVDIQAIKIWARQILDGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAIL
RGSHRAHSVIGTPEFMAPELYEENYDELVDVYSYGMCVLEMITYEYPYSECTNPAQIYKK
VISGKKPRAFYKVQDLEAQRFIGRCLESASKRLPAKELMLDPFLALGDFDDKPESRNDIQ
KPFQNDNIKIEDLQLNEDLPRTNMTITGKLNPEDETIFLKVQIADRDGDVRNVFFPFDIV
SDTPIDVANEMVKELEIADWKPSEIADMIDAEITGLVPNWKSDNPQSAHFHMMNYQEDHY
DHNNPFSPSSSSQVSLLGSIASQKIDVKPQSGHWIQDDLYDDTSSQSSSHSEKYSNWTYN
SADEHDPVMSPRRHNLYVGNTPTSSRFHPGENSGTGQYLAKICYKQCNDVLESKGASSTS
KNKMEMPRLTRNRSLVDTRSQLLHQSLVEEVNRRRLFKTVDAVESIGFRAPYEVSSKSAQ
RHCSVRCSSDCKKLGHKGRRF
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggcacaacacacaggtgaatcaatggatgaaaatggatacgctgaaactgat
ccaaccgggcgatatggacgattcgatgaagttctggggaagggggcaatgaaaacagtg
tacaaggcaatagatgaggtgcttggtatggaagtagcatggaatcaaatccacctcaat
cacttgcttcagtcaccggaggatctgcaacgactctactctgaagttcatcttctcagc
accctaaatcacaagtcgatcatcaaattctacacttcttggatcgatgttgaacaaaga
acctttaatttcatcactgaaatgttcacttccggcaccctcagagaatacagagcaaag
tataagcaagtggacattcaagccataaagatatgggcgcgacaaatacttgatggcctt
gtttatttgcatggtcatgatcctccagtgatccatagagaccttaagtgtgataacata
tttgtcaatggccatcttggacaagtgaaaattggtgatctgggcttggcagcaatttta
cgtgggtcacatagagcacacagtgttataggcacacccgagtttatggcaccagaatta
tatgaagaaaactacgatgaactggttgatgtatattcgtatgggatgtgtgttttagag
atgataacttatgaatatccatacagtgaatgtaccaaccctgctcaaatttacaagaaa
gtgatatcaggaaaaaagccaagagcgttctacaaagttcaagatttggaagcccaaaga
tttattgggagatgcttggaatctgcatcaaagagattaccagcaaaggagctaatgctt
gatccatttcttgcacttggtgactttgatgataagccagagtcgagaaatgatattcaa
aagccttttcagaatgacaatattaaaatcgaggatctgcagttgaatgaggatttacca
aggactaacatgactattacagggaagctgaaccctgaggacgagaccatctttcttaaa
gtacaaattgctgatagagacggtgatgttaggaacgtgttttttccctttgacattgtt
tccgatacccccattgatgttgcgaatgaaatggtgaaggagttagagattgccgactgg
aagccatcagaaattgcagatatgattgatgcagaaattactggtcttgtgccgaattgg
aagtcggacaatcctcagtcggctcacttccatatgatgaactatcaagaggatcattat
gatcacaataatccattctcaccttcctcatcgtcccaagtgtcactcttgggctcaatc
gcgtctcagaaaatagatgtaaaacctcaaagtggtcattggattcaagatgacttgtac
gacgatactagctcgcagagctcttcacactccgaaaagtattccaactggacttacaat
tctgctgatgaacatgatcccgtgatgagcccaagaagacacaacctgtacgtcggtaat
actccaacttcttctcgattccatcctggagaaaattcaggcacagggcaatatcttgct
aagatttgctacaagcagtgcaatgatgtgctagaatcaaaaggagcttcttccacttct
aaaaacaagatggaaatgcctagattgacaaggaaccggtcactagtggatacgcgcagc
cagttgcttcaccagtcattagtagaggaggtcaataggagacggttattcaagactgtt
gatgctgtggaaagtattgggtttcgagcaccttacgaggtttctagtaaatccgcacag
cgacattgttccgtgagatgttcaagtgattgtaagaaactaggtcacaaagggagaaga
ttttaa

DBGET integrated database retrieval system