KEGG   Olea europaea var. sylvestris (wild olive): 111394702Help
Entry
111394702         CDS       T05244                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 2-like
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00564  Glycerophospholipid metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111394702
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     111394702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase EF-hand_8 EF-hand_5 EF-hand_1 C2 EF-hand_7 EF-hand_6 CAF20
Motif
Other DBs
NCBI-GeneID: 111394702
NCBI-ProteinID: XP_022876414
Position
5
AA seq 659 aa AA seqDB search
MGHGASKNEAFDESSDSSGSMSSRIHELRHRLHLHRRRRHHHHHRRRHGSGSNSKPNLSK
QLLKEEDFVGIALLRLIRAEMKFKDKWLSCVSLGEQTFRTVISDQTDKPVWNSEKKFLLD
KKGAHVARISVFETNRLSKNNLIGYCEIDLLEFFTQDSDLEMKVDLKDPSAATVVVGSIY
LSCSIEDPIETEKSFVSRILSIVDYNEDGNLSFAEFSDLIDAFGNQLAANKKEELFKAAD
EDGNGVVSMDELAMLLVVQQEKDPLINCCPVCGEILEVPDRLNTMIHLTLCFDEGTGNQV
MTGGFLTDKQASNGWMFKVSEWAHFSSYEVGLRSGSGASHILVFDRRTKRLVEEIIDAKI
ILSMRAIYQSKLGLGLMDKRAKELLHSISEKQGRKMDSVKSAKDIPKFVDMFKDQINLSE
VKYPLEHFKTFNEFFIRELKPGARTIACMERDDVAVCAADCRLMAFKTATDSLRFWIKGR
KFSIQGLLGTEVCSSSFLDGTLVIFRLAPQDYHRFHFPVSGTIEKFVDIPGCLYTVNPIA
VNSKYCNVFTENKRVAALISTADFGKVACVAIGATMVGSITFSRKEGDYGKKGDELGYFS
FGGSTVICVFEKDTIKIDDDLLENSARSLETLVSVGMRLGISTKKPSDSKLPNIEKIIL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggggcacggggcttcgaaaaatgaagcctttgacgagtcaagtgacagttcaggctca
atgtcatcaagaattcatgaactccggcaccggctccacctccaccgccgccgccgccac
catcaccaccaccgtcgtcgccacgggagtggctcaaactcgaagcccaatctctccaaa
caactcctcaaagaggaggactttgtgggcatcgccctcctccgcctcatcagggcggaa
atgaaattcaaggacaaatggctttcttgtgtttcgctaggggaacagacttttcgcact
gttatttctgatcaaactgacaagcctgtctggaattctgagaaaaaatttcttttggat
aaaaagggggcacatgttgcgagaatatctgtatttgagaccaatagattatccaagaac
aaccttattggctattgtgagattgatctacttgaattttttactcaggattctgatttg
gagatgaaggttgatctaaaagatccatcagctgctacggtcgttgtaggcagtatatat
ctatcatgttcaattgaggatccaatagaaacggagaaaagttttgtgagtcgcatcttg
tctatagtggactacaatgaagacgggaacctttcgtttgctgagttctcagacttaatt
gatgcattcggcaatcaactggcggctaataagaaagaggagcttttcaaagcagctgat
gaggacgggaatggtgttgtaagcatggatgagttggctatgcttttggttgttcaacaa
gagaaggatccacttatcaattgttgtcccgtctgtggtgaaattcttgaagttccagat
aggttgaataccatgatacatttgaccctttgttttgatgaaggaactggaaaccaggtt
atgacaggaggattcttgactgataagcaggcttcaaatgggtggatgtttaaagtaagt
gaatgggctcatttttcatcatatgaagttggattgagatctggatcaggtgcttcgcat
attttggtttttgatcggagaacaaagagattagtggaggaaataattgatgccaagatt
attctgtcaatgagagccatatatcaatctaaactagggcttggccttatggataaaagg
gcaaaggaactgttgcatagtatctcagaaaagcagggcaggaaaatggattcagtcaaa
tctgctaaagacataccgaaatttgttgatatgtttaaggatcaaatcaatttatctgaa
gtcaaataccctttagagcattttaagacatttaatgaatttttcataagagagttaaaa
cctggtgcaagaacaattgcctgcatggagcgtgatgatgttgctgtgtgtgctgccgat
tgccggctgatggcttttaaaactgctacagatagtctaagattttggatcaaggggcgc
aagttttctatccaaggtcttttaggtacagaagtgtgctccagctcgtttcttgatggc
actttagtgatatttcggttggcaccacaggattaccatcgtttccattttcctgtttct
ggaactattgagaaatttgtggatattcctggatgcttatacacggtgaaccctattgcc
gtgaatagcaagtattgtaatgtgttcactgagaataaacgtgttgccgctctcatttca
acagcagattttggaaaggtggcgtgtgttgctattggagcaactatggttggcagcata
actttctctagaaaggagggtgattatgggaagaaaggagatgagcttggttatttctca
tttggtggaagtactgtgatttgcgtttttgaaaaggatacaatcaagatagacgacgat
ctcttggaaaacagtgcaagatcacttgaaaccttagtttctgttggaatgagacttggc
atctccacgaagaaaccatctgatagcaagttgccaaacatcgaaaaaatcatactatag

DBGET integrated database retrieval system