KEGG   Olea europaea var. sylvestris (wild olive): 111395622Help
Entry
111395622         CDS       T05244                                 

Definition
(RefSeq) probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1
  KO
K16054  methylthioribulose 1-phosphate dehydratase / enolase-phosphatase E1 [EC:4.2.1.109 3.1.3.77]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00270  Cysteine and methionine metabolism
oeu01100  Metabolic pathways
Module
oeu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    111395622
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.77  acireductone synthase
     111395622
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     111395622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II Hydrolase
Motif
Other DBs
NCBI-GeneID: 111395622
NCBI-ProteinID: XP_022877475
Position
6
AA seq 444 aa AA seqDB search
MAAASAAPLAISGVVKMGTLPQAYLESQKVKETKALISELCRQFYHLGWVSGTGGSITIK
VHDDSIPKSQQLIVMSPSGVQKERMVDEDMYVLSPNGSILSEPLAKPWPHKAPKCSDCAP
LFMRAYEMRNAGAVIHSHGMESCLVTMINPLLKEFRITHMEMIKGIQGHGYYDELVVPII
ENTAHERELTESLAEAIKAYPKATAVLVRNHGVYIWGDSWISAKTQAECYHYLFDAAIKL
HQLGLDCSTPSHGPIHSPNGILGSNGKVSAKAGILSSNNSIEPSRRCIILDIEGTTTPIS
FVTDVLFPYARENVGKHLELTYEEAETQDDIKLLKAQVLEDLENGIAGAVPIPSDGGKEE
VIAALVANVEAMIKADRKITSLKQLQGHIWRTGFQRNEIESLVFDDVPEALEKWHALGIK
VILASNLFIKPARIFLETVAPSVS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcttcagcagccccacttgccattagcggagttgtgaaaatgggcacccta
ccacaggcatatttggaaagccagaaagtcaaagaaactaaagcccttatttcggagctg
tgccgccagttctaccacctgggttgggtttctgggactggtggcagcatcacaatcaaa
gtccatgatgactcaattcctaaatcccaacagcttattgtcatgtccccctcaggtgtg
cagaaggaaagaatggtggatgaggatatgtatgtgttgtcaccaaatggatcaatcttg
tctgaaccattggcgaagccatggccccataaagctcccaaatgttctgattgcgctccc
ctgttcatgagggcatatgagatgcgtaatgctggtgctgtcatccacagtcatggaatg
gaatcttgcctcgtaacaatgatcaacccattattaaaagaatttcggattactcatatg
gaaatgatcaaaggaattcaagggcatggatattatgatgaacttgtcgtcccaattata
gagaatactgcccatgagagagagctcacagaatctctcgccgaagcaattaaagcatac
cccaaagctacagctgtgcttgtccggaaccatggagtatacatatggggtgattcttgg
attagtgcaaaaacccaggctgaatgttaccactatctctttgatgctgcaattaaactc
catcaattaggattggactgttcaactccttctcatggtcccattcatagtcccaatgga
attttaggctcgaatggaaaagtttctgcaaaggcagggattctttcttcaaataatagc
attgagccatcaagacgctgcattatactggatattgaaggaaccaccactcctatatcg
tttgttacagatgtgctctttccgtatgcacgtgagaatgtggggaagcatctagaactg
acatatgaagaggcagaaactcaagatgatatcaagttactcaaagctcaggtcctagaa
gatctagaaaatggtattgctggtgcggttcccatcccctctgatggagggaaagaggag
gtgattgcagctttggttgctaatgtggaggcaatgattaaagctgaccgtaaaattact
tccttgaagcaattacaaggtcacatatggcggacaggatttcagaggaatgagatagag
tcacttgtgtttgatgatgtacctgaagctctggaaaagtggcatgccttgggaatcaag
gttattcttgcttccaacttgttcataaagcctgcacgtatctttttggaaactgtagct
ccatcagtatcatag

DBGET integrated database retrieval system