KEGG   Olea europaea var. sylvestris (wild olive): 111396279Help
Entry
111396279         CDS       T05244                                 

Definition
(RefSeq) malate synthase, glyoxysomal isoform X1
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00620  Pyruvate metabolism
oeu00630  Glyoxylate and dicarboxylate metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111396279
   00630 Glyoxylate and dicarboxylate metabolism
    111396279
Enzymes [BR:oeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     111396279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 111396279
NCBI-ProteinID: XP_022878435
Position
6
AA seq 569 aa AA seqDB search
MVGFESFLEPSSTERKIGMAYDVPEGVDIMGKYDAEFAKILTKDALQFVADLQSEFRNHI
KYALECRKEAKIRYNNGGLPGFDPATKYIREGEWVCAAVPPAVADRRVEITGPVGRKMII
NALNSGAKVFMADFEDALSPSWENLMGGQVNLRDAVNRTISFHDKARNRVYKLNDQTAKL
FVRPRGWHLPESHIFIDGEPATGCLVDFGLYFFHNCMAFRRTQGEGFGPFFYLPKMEHSR
EAKIWNNVFERAEKLSGIEKGSIRATVLIETLPAVFQMDEILYELRDHSVGLNCGRWDYI
FSYVKTFQAHPDRLLPDRVLVGMTQHFMRSYSDLLIRTCHKRGVHAMGGMAAQIPIRDNP
VANEAALELVRKDKLREVKAGHDGTWAAHPGLIPAIMEVFTNSMGNKANQIHTVKREDAV
NLTEEDLLQRPRGVRTMEGLRHNTRVGIQYLAAWLTGTGSVPLYNLMEDAATAEISRVQN
WQWLKYGVELDGDGLGVKVTLELFGRVVEDEMTRIEREVGQEKFKKGMYKEACKIFTRQC
TKPMLDDFLTLDAYNHIVNHYPKGSSSRL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggtgggttttgaaagctttcttgaaccttcctctacagagagaaaaattggcatggca
tatgatgtgcctgagggagtggacattatgggcaaatatgatgcagaatttgcaaaaatt
ttgactaaggatgctctgcaatttgtggctgatttgcagagtgagttcaggaaccatatc
aagtatgctttggagtgcagaaaggaggctaagattagatacaataatgggggtttaccg
gggtttgatccggctacgaaatacataagggaaggggaatgggtttgtgccgccgtgcca
ccggcggttgccgatcggagggtggaaattacagggcctgtggggaggaagatgatcatc
aatgcactcaattctggagccaaagttttcatggctgattttgaagatgctctctcacca
agctgggagaacttaatgggtggacaagttaacttaagggatgctgttaataggactata
agcttccatgacaaagctagaaatcgggtttacaagcttaatgatcagacggctaagctt
tttgttcgtccaagaggctggcacctacccgagtctcacatcttcattgatggcgaacca
gctaccggttgccttgtggacttcggtctctattttttccacaactgcatggcgtttcgc
cgaactcaaggtgaaggcttcgggcctttcttctatctcccgaaaatggaacactcgagg
gaagcaaaaatctggaacaatgtatttgagagggccgaaaaattgtctggaattgagaag
ggaagcattagagccactgttttgattgaaacgcttccagccgtttttcaaatggatgaa
attctgtatgagctaagagaccattctgttggtctgaattgtggtagatgggattatata
ttcagctatgtcaagactttccaggcccacccggatcgccttctgcccgatagagttcta
gtggggatgactcagcacttcatgagaagttactccgatttactcatcagaacctgtcat
aagcgtggcgtgcatgccatgggaggaatggctgctcagattcctatccgggacaaccca
gtggcaaacgaggcagctttggaattggtaaggaaggacaaattgagagaagtgaaggcg
gggcatgatggaacatgggcagcccacccgggactgatcccggccatcatggaagtcttc
accaacagcatgggcaacaaggcgaaccaaattcacaccgtgaagcgtgaagatgcggtt
aacttgactgaagaagacctccttcagaggccaagaggagtacgaaccatggaaggcctc
cgtcacaacaccagggtcggaatccagtacttggcagcatggctcacgggaactggttcc
gttcccctttacaacctcatggaggatgcggccacagctgaaataagccgagtccagaac
tggcagtggttgaaatatggagttgaattggatggagatggccttggtgtgaaggtgact
cttgagctcttcgggcgagtagttgaagacgaaatgactaggattgagagagaagttggc
caagaaaaatttaagaaaggaatgtacaaggaggcttgcaagatttttaccaggcaatgc
actaaaccaatgttggatgattttctgacccttgatgcctataatcatattgtcaaccac
taccccaagggatcatcctctaggctctaa

DBGET integrated database retrieval system