KEGG   Olea europaea var. sylvestris (wild olive): 111396307Help
Entry
111396307         CDS       T05244                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase WAK_assoc GUB_WAK_bind Kinase-like ABC1 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 111396307
NCBI-ProteinID: XP_022878472
Position
6
AA seq 669 aa AA seqDB search
MKQNMYTFLISFELCIFCIILVAKQSFCVDYRYEACVPKSCGNGPNISFPFYIHDKQESY
CGFPGFELNCTNSGYPVLHLQGKDVMVQNISYETRILRVYDAAVSSSNGSCFSQIKNTTL
PEKFNYVNVSYLYLLSNCTGNLSEDLSRHRIGCGNQSRDNWGLAVFEGNENFKNALGNCE
QKVVAPVELHGGEERNGTRNYMEILRRGVALNWTASDCNVCAKSRGRCGFDATVYQFKCF
CPDRPHSSSCKPEKIKMRPSLRLILATAIPGGVIILLLLFSFIIWCLKRTYDARNISSDP
STKSIIEGGNLCFGIPIFSYTELKEATNNFDSLKELGDGGFGTVYHGKLHDGREVAIKRL
YEHNYKRVEQFMNEIKILTCLRHRNLVSLYGCTSTRSRELLLVYEYIPNGTVADHLYGDT
AKEAPLKWPVRLNIAIETAQALAYLHASDIIHRDVKTTNILLDDNFCVKVADFGLSRLSP
TDVTHISTAPQGTPGYVDPEYHESYQLTNKSDVYSFGVVLIELISSMPAVDISRSRHEIN
LANLAVNKIQRSAFNELIDPSLGFEFDDEVRRMTTSVAELAFQCLQLEKETRPKMDEVLH
ILKEIRAEDEFDVDKTKENIDDYSVPRIKKIPPSPESEGAVLLKNKFQESPNCVTDTWYS
ASSGNSSSF
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatatgtacacattcttgatatcgtttgagctttgtatattctgcataatt
cttgttgcaaagcaatcgttttgtgtagattatcggtatgaagcatgtgtgcctaagagt
tgcggcaatggcccaaatataagtttcccattctatatccatgacaagcaagaatcatat
tgtgggttccctggatttgagctcaactgcacaaacagtggctaccccgtacttcattta
cagggaaaggatgttatggttcaaaacatttcatacgaaacccgtattttgcgagtatat
gatgctgcagtttcaagttcaaatggaagctgtttttcacagattaaaaacacaacactt
cctgaaaaattcaattatgttaatgtttcgtatctgtacttgttatcaaattgtacagga
aatctgtctgaggatctttctaggcacagaattggttgtggtaatcagagtagagataat
tggggtttggcagtgtttgagggtaatgagaactttaaaaatgcattggggaattgtgaa
caaaaagtggtggcgccggtggaattgcacggcggtgaagagaggaatggaacaagaaac
tatatggagattttgagaagaggggttgcactgaattggacagccagtgactgtaatgta
tgtgcaaaaagtagggggcgttgtgggtttgatgcaactgtttaccagttcaagtgtttc
tgcccagacagacctcattcttcaagttgcaaacctgaaaagattaagatgaggccaagt
ctgaggctgattttagccacagctatacctggaggtgtaatcatacttctcttgctgttc
tcttttatcatttggtgccttaaaaggacttatgatgcaagaaacatatcttctgatccc
tccacaaaatcaatcatcgaaggtgggaatttatgctttggcatccctatcttctcctac
actgagcttaaagaggccaccaacaattttgattctttaaaagaacttggagatggaggt
tttggcactgtataccatggcaaacttcatgatggaagagaagttgcaataaagcgccta
tatgagcataactacaaacgagtcgagcagttcatgaatgaaattaaaatccttacttgt
ttgaggcaccgtaatcttgtttctctctatggatgcacatccacaagaagccgcgaactc
ctacttgtttatgaatacattcctaatggcacagttgccgatcatctttatggggacaca
gctaaggaagcaccactcaagtggccagttcgcttgaacattgccatagaaactgctcaa
gcattggcttatttacacgcatctgatataatacatcgtgatgttaagacgaccaacatc
ctgcttgatgacaatttttgtgtcaaagttgcagattttgggctctctagactctctcct
accgatgtcactcatatttccactgcccctcaggggactcccggatatgttgatcctgaa
tatcatgaatcttaccagctaaccaataaaagtgatgtttacagttttggagttgttctc
atcgagcttatttcctcaatgccggctgttgatataagcaggagtaggcatgaaatcaac
ttggcaaatttagcagtaaacaagatccaacgaagtgcatttaatgaattaattgatcca
tctctaggatttgagtttgatgatgaagttagaaggatgactacatcagtagcagaatta
gcgtttcagtgtctgcaacttgaaaaagaaacgagacctaaaatggacgaggtattgcat
attttgaaggaaattcgggctgaggacgagtttgatgttgacaagactaaagagaatatt
gatgactatagtgtgccaagaattaaaaagattcctccatccccagaatcagaaggtgct
gtattgttgaagaataaatttcaagaatcaccaaattgtgtgactgatacatggtatagt
gcatcttctggaaatagttccagtttttga

DBGET integrated database retrieval system