KEGG   Olea europaea var. sylvestris (wild olive): 111397266Help
Entry
111397266         CDS       T05244                                 

Definition
(RefSeq) uncharacterized protein LOC111397266 isoform X1
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00900  Terpenoid backbone biosynthesis
oeu00909  Sesquiterpenoid and triterpenoid biosynthesis
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111397266
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111397266
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     111397266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 111397266
NCBI-ProteinID: XP_022879864
Position
7
AA seq 340 aa AA seqDB search
MKDTVLVTGASGYLGGRLCHALVDQGYHVKAFVRKTSNISSLPPLTDGGETLELAYGDVT
DYKTLLEACNGCQLIFHAAALVEPWLPDPSKFFSVNVGGLKNVIQACKETKSIQKIIYTS
SFFALGSTDGYIADETQVHPGKHFCTEYERSKAMADKIALEAASEGLPIVLIYPGVIYGP
GKVTNGNFVSQMLVERFNGRLPGYVGNGDDKCSFCHIDDVVQGHIAAVHKGRPGERYLLT
GENMSFRDVFDLAASITKTAKPRFTIPLCMVEMYGRLSVIGARITGKLPIVSPPTVDVLR
HQWAYSCEKAKAELGYNPRSFKDGLTEMLPWLKNLGLIKY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatactgtattggtgacaggtgcttccggctacttaggcggtaggctctgccat
gccctcgtcgatcaaggctaccacgttaaggcttttgtccgcaagaccagtaacatatcc
tccttacctccgctcactgacggtggcgaaactcttgagctggcttatggagatgttacc
gattataagaccctgttggaagcttgcaatggttgccagttaatcttccatgctgctgcc
ctcgtcgagccctggcttcctgacccctcgaaattcttctcagttaatgtgggaggattg
aagaatgttatacaggcatgtaaagagacaaaatcaattcagaagattatttatacatcg
tcgtttttcgctttgggatccactgatgggtatattgcagatgaaactcaggtgcaccct
ggtaaacatttctgtacggagtacgaaagatcgaaggccatggctgacaaaattgctttg
gaagctgcatctgagggtttgccaatagtgctgatttacccaggagttatatatggtcct
ggcaaagtgacgaatggaaattttgtatcgcaaatgctcgtagaacgctttaatgggcga
ttacctggatatgtgggaaatggagatgacaagtgctctttctgtcacatcgatgatgta
gttcagggacacattgctgcagtgcacaaaggtcgaccaggtgaaaggtatcttctcaca
ggagaaaatatgtcattcagagatgtttttgatttagccgctagcatcactaagacggca
aaacctcggttcaccatcccactgtgtatggttgagatgtatggacgtctatctgttatc
ggtgcccgaataactggaaagcttcctatagtcagtcccccgactgttgatgttctgaga
catcagtgggcttacagttgtgagaaggccaaggcagagctgggttataacccgagaagc
ttcaaggatggtctaacagaaatgcttccctggttaaagaatttgggtttgattaaatat
tag

DBGET integrated database retrieval system