KEGG   Olea europaea var. sylvestris (wild olive): 111397538Help
Entry
111397538         CDS       T05244                                 

Definition
(RefSeq) protein HASTY 1
  KO
K14289  exportin-5
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111397538
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oeu03016]
    111397538
   03036 Chromosome and associated proteins [BR:oeu03036]
    111397538
Transfer RNA biogenesis [BR:oeu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    111397538
Chromosome and associated proteins [BR:oeu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     111397538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 111397538
NCBI-ProteinID: XP_022880288
Position
7
AA seq 1198 aa AA seqDB search
MEESGIANNVARAILAALDWKSSPEARNVAYSYLESIKAGDVHILANTSFLLVKRDWSSE
IRLHAFKMLQHLVRLRWDELTPTERRNFASTAVNLMSEIANPCEEWALKSQTAALVAEMV
RREGLSLWQELLPIIIPFSSTGPIQAELVAMMLRWLPEDITVHNEDLEGDRRRLLLRGLA
QSLTDILPLLYTLLETHYGAALAEASRQQMDIAKQHAATVTATLNAVNAYAEWAPLPELA
KYKIIQGCGFLLNAPDFRLHACEFFKLVSPRKRPIEATSDFDSAMCNVFQILMNIAKDFL
LKSSSGASFDESEFEFVEYICESMVSLGSTHLQCLVCDSTVLSFYLQQMLGFFQHSKLAL
HYQSLLFWLALMRDLLFKSKTAGIRDNNLSSGTTQAHSEKRKMLDLVNDDICNAMLDTSF
QRMLKKEKVNPGMALHDGTLELWSDDFDSKIDFSQYRSRLLELFRLIASDKPVVAAAKVS
ERITEIIRSPVLVPIPAKDLAVMESLQLVLENVVSVVFDGLNEFGNSSHEVHLILCQIFE
GLLQHLISLKWTEPELVEVLGHYLDALGPLLRHRPDAIGIVINKLFELLTSLPFMVKDPS
TSTARHARLQICTSFIRIAKAANESLLPHMMGIADKMTYLQKEGLLLWAEHNLLAEACLV
MASVAGVQQQQEVLVWLLEPLHRQWMQPDWQEAYLSNPTTLVRLCTETQFMWSIFHTVTF
FEKALKRSGFRKGSISSQNIPIKNSPVTHPMASHLSWMLPPLLRLLRAIHSLWSPPVIQA
LPGEIKAAMIMSDVERSSFTGEGSLKQPKGALAFTDGSHFDISMEGYSEPAETDLRNWLK
GIRDSGYSVLGLSATIGDSFFGGRDSHSVSSALMENIQYMEFRHIKQLVHLVLIPLVRSC
PPNEWEMWLQNLLRPLFIHAQQALSCSWSSFLRDGKAMVPDLHGIDDGSNLSVELMEEKL
LRGLTREICSLLAVLASPGLNAGLPSLEHAGQISRGDVSSLKGLDTFTSSSVVGFTLKNK
SLALPVLQICLESFSWPHGEAVTRVSSFCGLVILLAISTNDVELREFVCKDLFSAIIQGL
TLESNAIISAELVGLCREIFVYLSDRDPKPREILLSLGSTPQDLLAFEEALTKTSSPKEQ
KQHMRSLLVLAAGDKLKALASQKSVNVITNVTARPHNLGSSRETNVDEGDSIGLAAIM
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaagtggaatagcaaacaacgtggctcgagccatactcgctgcccttgactgg
aagtcctctccagaggctcgcaatgttgcctattcctacttagaatctataaaagccggg
gatgtccatatcttggcaaatacatcctttcttttagttaagagagattggtcttctgaa
atccggttgcatgctttcaaaatgctccagcatttagtgcggttgcggtgggacgagtta
acccctacagagcgaaggaactttgcaagtacggctgtcaatctaatgtctgaaattgca
aacccctgcgaagaatgggctttgaaaagtcagacagctgctcttgttgctgagatggtt
cggagagaaggcttaagtttatggcaggaacttcttccaataataattcccttctctagc
actggtcctatccaagctgagctggtagcaatgatgctaaggtggcttcccgaagacatt
actgttcataatgaagatttagaaggtgataggcgcaggcttttattacgtggattagct
caatctttgactgacattttgccactgttatacactttattagagacacattatggagct
gcacttgctgaagcaagtaggcaacaaatggatattgcaaaacagcatgcagcaactgta
acagctactcttaatgctgttaatgcatatgctgagtgggctcctttaccagagcttgcg
aaatataaaattatacaaggttgcgggttcttactcaatgctcctgactttcgtcttcat
gcatgtgagtttttcaaacttgtctcaccaaggaaaagaccaatagaagccacttcagac
tttgattctgcaatgtgtaatgtttttcagattttaatgaatattgcaaaagatttcttg
ctgaaatcgagctctggtgctagttttgatgaaagcgaatttgaattcgtggaatacata
tgtgaaagtatggtttcattgggttctacccacttgcagtgcttggtctgtgatagcaca
gttctctccttttaccttcaacagatgctcggttttttccaacattctaagcttgcgctt
cattatcaatctctactcttttggctggcattgatgcgtgacttgctgttcaaatctaag
actgctggcataagagacaacaacctgagctcaggcacaacacaagctcatagtgaaaag
agaaagatgttagatttagtaaatgatgatatctgtaatgctatgttggatacatctttc
caacgcatgctgaagaaagaaaaagttaatcctgggatggcacttcatgatggaactttg
gagttgtggagtgatgattttgacagcaaaatagatttcagtcaataccgttcacggctg
ttggagctgttccgtcttattgcatctgataagcccgttgttgctgctgctaaagtttct
gagagaatcactgaaattattagaagtcctgtccttgtcccaatacctgctaaggatttg
gctgtgatggaaagcttgcagttggttctagaaaatgttgtcagcgtagtttttgatggt
ttaaatgaatttggcaatagtagccatgaagttcatcttatattatgtcaaatatttgaa
ggtctacttcaacatcttatttctttaaaatggactgaaccggaacttgtagaagttctt
ggtcactatttagatgcattgggtccacttctgaggcaccggcctgatgccattggcatt
gtcatcaataaactcttcgaacttttgacctctctgccttttatggttaaggatccttca
actagtactgctcggcatgcgagattgcagatatgtacatcttttattcgaattgcaaag
gccgccaatgaaagccttctgcctcacatgatggggattgctgacaaaatgacatatttg
caaaaggaaggccttttgctttgggcagagcataaccttctagctgaagcgtgtcttgtt
atggcatctgttgctggggttcaacagcaacaggaagttttggtctggttgcttgaacct
ttgcacaggcaatggatgcagccagactggcaagaagcatacttgtctaacccaaccacc
ttagttcgcctctgtactgagactcaatttatgtggtcaatattccacactgtcacattc
tttgagaaggcactaaagagaagtggttttagaaaaggcagtataagttcacaaaatatt
ccaataaaaaattctcctgttacacatccaatggcttcccatctttcgtggatgctgcca
cctctccttagactacttcgtgcaatccattctctttggtctccacctgtgattcaagcc
ctccctggagaaataaaagctgcaatgattatgagcgacgttgaaagatccagttttact
ggggaaggaagccttaaacagcccaagggtgcattagctttcactgatggatctcatttt
gatatcagtatggaaggctattcagagccagctgaaactgacctacgaaattggttgaaa
ggaataagagatagcggctatagtgttttaggtttatcagccacaattggtgattcattt
ttcggaggcagagactctcattctgttagttcagcactgatggaaaatatacaatacatg
gagttcaggcatataaagcagcttgttcacttggtgctgattcccttagttagatcctgt
cctccaaatgaatgggagatgtggctgcaaaacctcctgcgtccattatttatccatgct
cagcaggctcttagctgttcatggtctagttttttacgagatggaaaagcaatggttcca
gatctccatgggatagatgatgggtcaaacttgagtgtggaattaatggaggagaagctt
cttcggggtttgactcgtgagatttgttctctccttgctgttcttgcttctcctggactt
aatgctgggcttccttcattagagcatgctggccaaatcagccgcggggatgtttcttct
ctcaaaggcttggatacctttacctcaagctctgtggttggatttacactgaagaataaa
agccttgcgcttccagtcctgcagatatgtctggaatcattcagttggccacatggtgaa
gctgtgacaagggtttcttctttctgtggactagtaattctccttgcaatttctactaac
gatgtggagctcagagaatttgtatgtaaagacctgttttctgcaattatccaaggtttg
acacttgagtcaaatgctataataagtgctgaattagttggtctctgtcgggaaatcttc
gtctacctgtctgatagagacccaaaacccagggagattttgctctctcttggcagtacg
ccccaagatctgcttgctttcgaagaagctttaacaaagacaagtagtcccaaagagcaa
aagcagcacatgagaagtttattagtattggcagctggagacaagttaaaagctctcgcg
tctcagaaaagcgtgaatgtaattacaaatgttacagcgaggcctcacaatttgggttct
agtcgtgaaaccaatgtcgatgaaggagattctattggcttggctgcaattatgtaa

DBGET integrated database retrieval system