KEGG   Olea europaea var. sylvestris (wild olive): 111397554Help
Entry
111397554         CDS       T05244                                 

Definition
(RefSeq) alcohol dehydrogenase-like 7
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00010  Glycolysis / Gluconeogenesis
oeu00071  Fatty acid degradation
oeu00350  Tyrosine metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111397554
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111397554
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111397554
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     111397554
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     111397554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C TrkA_N ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 111397554
NCBI-ProteinID: XP_022880313
Position
7
AA seq 389 aa AA seqDB search
MAKNSAGSSETAGKPIRCRAAVVRQAGEPMVIEEIIVAPPGSAEVRVKIICTSLCHSDVT
FWKLKDPPGFVPRILGHEAVGIVESVGEDVQEFSEGDTVIPIFLPDCTECADCTSKKSNL
CSKYPFEVSPWLHRDGTSRFTDLKGETLYHFLFVSSFSEYTVLNTANVTKVDPAIPPNRA
CLLSCGVSTGVGAAWRTANVEARSTVVIFGLGAIGLAVAEGARLCGAKKIIGVDINPQKF
ETGKIFGVTDFVDSRNCGDKSVRQVINEMTNGGADYCFECVGMASLVEEAYACCRKGWGK
TVVLGVDKPGAELKFSSFEVLHSGKTITGCLFGGLKPKSDISTLVKRYMDKELQLDEFVT
HEVGFEDINKAFDLLLEGKSLRCVIWMDK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaattcagcaggttccagcgaaactgccgggaagcccataagatgccgagcg
gctgtggttaggcaagcaggggagccaatggtgattgaggaaattattgtggcacctcca
ggatctgctgaagttcgagtcaaaattatatgcacttctctctgtcacagcgatgtcact
ttctggaaattaaaggatcctcctggttttgttccaagaattctggggcatgaagcggtt
ggcattgtggagagtgttggggaggacgtacaagaatttagtgaaggtgatactgtaatc
ccaatatttttgccagattgcactgaatgtgctgattgtacgtcaaaaaagagcaattta
tgttcaaaatatcctttcgaggtctctccttggttacacagagatgggactagcagattt
actgacctcaagggagagactttataccatttcttatttgtgtctagttttagcgagtac
acagttttaaatactgctaatgtaacaaaagtcgatcctgcaatcccgccaaacagagca
tgcctcctcagttgtggagtgtcaacaggtgtgggagctgcctggaggactgcaaatgtg
gaagcacgatcaacagttgtgatcttcgggttgggagcaattggattagcagttgcagag
ggagcgaggttatgtggtgctaaaaaaatcattggtgtggatataaacccacaaaaattt
gaaacgggtaaaatatttggagtaactgattttgtcgactccaggaactgtggagataaa
tctgtgcggcaggtcataaatgagatgactaatgggggagcagactactgctttgaatgt
gttggaatggcttctttggtcgaggaagcatatgcttgctgccgaaagggttgggggaag
actgttgtgctaggggtggacaaacctggagcagagctgaaattcagttcatttgaagtc
cttcattctgggaaaactatcacgggatgcttgtttggaggtcttaaaccaaaatccgac
atctccaccctagttaaacgttatatggacaaggaattgcaactcgacgagttcgtgacc
catgaagttgggtttgaagacataaacaaagcttttgacttacttttggaaggaaagagc
ctcagatgtgtgatttggatggacaaatga

DBGET integrated database retrieval system