KEGG   Olea europaea var. sylvestris (wild olive): 111399613Help
Entry
111399613         CDS       T05244                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    111399613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oeu04131]
    111399613
   03029 Mitochondrial biogenesis [BR:oeu03029]
    111399613
Membrane trafficking [BR:oeu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    111399613
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    111399613
Mitochondrial biogenesis [BR:oeu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111399613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 111399613
NCBI-ProteinID: XP_022882793
Position
1
AA seq 514 aa AA seqDB search
MSREEITTEAIKHALKSLRKRHLLEEGAHAPAIIALSRPLVSQGSEWKEKAESLEVELQQ
CYKAQARLSEQLVVEVADSRVSKALVQEKEALISDLQNELSLARDERSRLTACLEEKSKA
LELLMNEHQSLKEQLEATTLRASNAEAENKMLIDRWMLQKMKDAERLNDANSVYGDILDQ
LKVSSIEQLARQQVDGVVRQSEEGAECYIESPIPTTCRQRIPAHNGGCASILFEYNSSKL
MSGGQDQTIKIWDTNTGSQSQTLHGCLGTVLDLCITHDNRSVIAASSANNLYVWDVSSGR
VRHTLTGHVDKVCAVDVSKVSTRSVVSAAYDRTIKVWDLHKGYCVNTLLFQSNCNTLCFS
MDGETICSGHVDGNLRLWDIKTGKLLSEVAAHSLAITSLSLSRNGNMILTSGRDNLHNLF
DIRTLEICATLRSNGYRVASNWSRSCISADDGYVASGSVDGSVHIWSVANAKIVSTLKEH
TAPVLSCSWSGLGKPLATSDKNGNICIWNDRSPF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagaagaaataacaacggaagcaataaaacacgctctgaaatcgcttagaaag
cggcatttactcgaagagggcgcacatgccccagctataatcgccctttcgcgccccctg
gtttctcagggatcggagtggaaagaaaaagctgaaagtcttgaagtggagctccagcag
tgttacaaagctcaagctcgactatcagagcagcttgtcgtggaagtggcggattccaga
gtttctaaagctttagttcaagagaaagaagccctgatctctgacttgcaaaatgagctt
agtctagcaagggatgaacgctctcgtttgactgcatgtttagaagaaaagagtaaagct
ttagaattgttaatgaatgagcatcagagtctgaaagaacaacttgaagcaaccactctt
agagctagtaatgctgaggcggaaaataaaatgcttattgaccgttggatgttgcagaaa
atgaaagatgctgaacgcctaaacgatgctaattctgtttatggagacatactagatcaa
ctaaaggtcagcagtatagaacaacttgcccgtcaacaagtggatggtgtagtgcgccaa
agtgaagaaggtgctgagtgctatatagaatcacccattccgactacatgtaggcaaaga
atcccggcccataacggtggctgcgcctctatactgtttgagtataattcaagcaagttg
atgagtggggggcaggaccagactattaaaatttgggatacaaacacggggtcacagagt
caaactcttcatggttgtctgggcactgttcttgatctctgcatcacccatgataacaga
tccgtcattgcagcaagtagtgcaaataacttgtacgtatgggatgtaagttcaggccgg
gtacggcacactctcacgggccatgtagacaaagtatgtgccgtagatgtgagcaaagtg
tctacccgcagtgttgtgagtgcagcatatgatcgaactataaaagtttgggatctgcat
aaaggttactgtgtcaacacactactttttcaaagtaattgcaatacgctttgtttcagt
atggatggagagaccatctgttcgggccatgtggatggaaatctccgactgtgggatatt
aagacgggaaaacttctaagtgaagttgcagcacattcactagctataacgtctctgtct
ttatctagaaatggaaacatgattttgaccagtggtagagacaacttgcataacttgttc
gatatacgtactctcgaaatttgcgccacattgcgctcaaatggttatagagtagcgtcg
aactggagcagatcgtgcatcagtgctgatgatggttatgttgcttctggatctgtcgat
ggatcagtacatatttggtcagtagcaaatgcaaaaatagtaagtactctaaaagaacac
acagctcctgttctatcttgctcctggagtggtctcgggaaacctttagctacatcggac
aagaatggtaatatttgcatttggaacgacaggtctcctttttag

DBGET integrated database retrieval system