KEGG   Olea europaea var. sylvestris (wild olive): 111400288Help
Entry
111400288         CDS       T05244                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase S.5
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Lectin_legB Haspin_kinase Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 111400288
NCBI-ProteinID: XP_022883472
Position
10
AA seq 374 aa AA seqDB search
MGKLKAKFSATVFVFCCFLAIVSTKKLDTFSRQFGSFDQTQHDIFVIEKPATINNGALQV
TPDSASADFNMYNNSGRILYKQPFKLWDGDNASSLIFISATGWCHKNGKLLLVYDYMPNG
SLDKHLFSEPNIEPLGWSLRYKIVSGVASALHYLHNEYEQRVVHRDLKASNIMLDSNFNS
RLGDFGLARALDNGKTSYAEAEGVLGTMGYIAPECFHTGKATQQSDVFAFGAVLLELVCG
IRPGTKIAGFQLLVDWVWFLHRDRRLLKAVDPRLGDEFVAEEAERLLLLGLACSHPTASE
RPKTQAILHIILGTVPVPNVPPFKPPFVWPAVESTDIDSSSVNTTSMTTSHFGSGWSPQD
LSMENYTGYTDSLV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactaaaagcaaaattcagcgccaccgtgtttgttttttgctgttttttggcc
attgtttcaactaagaaacttgatactttcagtcgacaatttgggtctttcgatcaaaca
cagcatgatatttttgtgattgaaaagcctgctactatcaacaacggtgcccttcaggtg
actccagattcggcttcggccgatttcaatatgtataacaattcaggcagaatcctctac
aaacagccctttaagctctgggatggtgataatgcatcatcactgatttttatttctgca
acaggttggtgccacaagaatgggaagcttctactggtgtatgattacatgcccaatgga
agcctggacaaacacctgttttccgagccgaacatagagccacttggatggagtcttcga
tataaaatagtttctggggtagcctcagccttgcactatctccataacgagtacgagcag
agggtagtacatcgggatcttaaggctagcaacatcatgctcgactccaactttaattcc
cgtctaggagactttggcctcgcacgggctcttgacaatgggaagacctcatatgccgag
gctgagggagtgctaggcacaatgggatacattgcacccgagtgtttccacactgggaaa
gccacacaacagtctgatgtctttgcatttggggcggtcttgttggaactggtgtgtggt
atacgtcccggaaccaagattgctggcttccaactcttggttgattgggtttggttcttg
catcgtgataggcgcttactcaaagctgtagatccgagattgggtgacgaatttgttgca
gaagaagccgagaggcttctgctgttggggttggcatgttcacatcctactgctagtgaa
aggcctaaaacacaggctatacttcacataatcttgggaacagtgccagtgccaaatgtt
ccaccgttcaagcctccttttgtgtggccagctgttgaatccacagatatagattcgagt
tcagtgaatacgacatcaatgacaacttcacatttcggctcaggttggagtccacaggat
ctgagcatggagaactatactggatacacagactccttggtgtag

DBGET integrated database retrieval system