KEGG   Olea europaea var. sylvestris (wild olive): 111402996Help
Entry
111402996         CDS       T05244                                 

Definition
(RefSeq) tripeptidyl-peptidase 2-like isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oeu01002]
    111402996
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oeu03110]
    111402996
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     111402996
Peptidases and inhibitors [BR:oeu01002]
 Serine peptidases
  Family S8: subtilisin family
   111402996
Chaperones and folding catalysts [BR:oeu03110]
 Intramolecular chaperones
  Subtilisin family
   111402996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 DUF825 CcdA
Motif
Other DBs
NCBI-GeneID: 111402996
NCBI-ProteinID: XP_022887099
Position
11
AA seq 636 aa AA seqDB search
MPSGEDNGALRNFKLNESTFLASLMPKKEIAADRFVEAHPEYDGRGVIIAIFDSGVDPAA
AGLQETSDGKPKILDVIDCTGSGDIDTSTVVKADDCRCIRGTSGATLVLNSSWKNPSGEW
HVGCKLVYELFTNTLTSRLKKEREKRWDEKNQEAIAEAVKQLDAYDKKHTKIEDANLKKV
REDLQSRVDLLRKQADSYDDKGPVIDAVVWHDGEVWRAALDTQSFDDEPGCGKLADFVPL
TNYSNLEGQLEYHISINQREIQQLEERSILWDPSFLQMDRDRIRPIPEMPFWIFLNVLAI
HGMIERKYGIFSKLDACTCVLNIYNEGNILSIVTDSSPHGTHVAGITAAFHQKEPLLNGV
APGAQLISCKIGDSRLGSMETGTGLTRALIAAVEHKCDLINMSYGEATLLPDYGCFVDLV
NEVVNKHRLIYVSSAGNNGPALSTVGAPGGTTSSIIGVGAYVSPTMAAGTHNLVEAPPEG
LEYTWSSRGPTADGDLGVCISAAGGAVAPVPTWTLQRRMLMNGTSMSSPCACGGVALLVS
AMKAEGIPVSPYSVRKALENTAIPVGGLPEDKLTSGQGLMQVDKAYEYVQKSCNVPCVWY
QVKVNQCGKPTPTSRGIYLREANSCRQKTEVRFHGQ
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgccttctggagaagacaatggtgctttacggaacttcaagctgaacgagtcaactttc
ttagcttcactcatgcccaagaaagaaattgctgcggatcggtttgttgaagcccacccg
gaatacgatggtcgtggagtgattattgcaatttttgattctggggtggacccggctgct
gctgggcttcaagaaacctctgatgggaagccaaagatcttagatgttattgattgcact
gggagtggagatattgatacatcaacggtagtgaaggctgatgactgtaggtgtatccgc
gggacatctggggctacattggttttaaattcttcatggaagaatccatctggcgaatgg
catgtgggttgtaaattggtttatgagcttttcacaaatacgctaacttctcgattgaag
aaagagagagagaaaaggtgggatgaaaagaatcaggaagcaattgctgaggctgtaaag
cagcttgatgcatatgacaagaagcacacgaaaattgaggatgcaaacttgaaaaaggtc
cgggaagatctccagagtagagttgatcttctacgcaagcaggctgacagctatgatgat
aaaggacctgtcatagatgctgttgtatggcatgatggagaagtttggagggctgctctt
gacacacagagttttgatgatgaaccaggatgtgggaagcttgctgacttcgttccttta
actaattatagcaacctagaaggtcaattggaatatcacatatcaatcaatcaaagagag
attcaacaactagaagaaagatcgattctttgggatccttcctttcttcaaatggacaga
gatagaatcagaccaattcccgaaatgcctttttggatattcctcaatgtcctggctatt
cacggaatgattgaacggaagtatggcatttttagcaaattagacgcttgtacatgtgtt
cttaacatatataatgaaggcaacattttgagtatcgtaaccgatagctctcctcatggt
acgcatgttgctggaataactgctgctttccatcaaaaggagcctttgttgaatggagtt
gcccctggagcacaattgatttcatgtaaaattggagattcacgcttaggttcaatggaa
acaggaacaggcttgactcgagcactgattgctgctgttgagcacaaatgtgaccttata
aacatgagttatggggaggccactttgctccctgattatggttgttttgttgatctcgtg
aatgaggtagtcaacaagcaccggctgatatatgttagtagtgctggcaacaatgggcca
gcattgagtactgtgggtgcacctggtggtaccacatcaagtattataggagttggtgca
tatgtttctcctaccatggctgctggaactcacaacttagttgaggctcctcctgaaggt
cttgaatatacctggtctagtcgaggaccaacagctgatggggatcttggagtctgcata
agtgccgctggaggagctgtagctcctgttcctacatggactcttcaacgacgcatgctt
atgaatggaacatcaatgtcatctccatgtgcttgtggtggggttgctctgcttgtcagt
gccatgaaggctgaagggattcctgtgagtccatacagtgtccgtaaggctctggagaac
acagcaattcctgtgggtggattgcctgaagataaactgacttctggacaagggcttatg
caagttgacaaggcctatgaatacgttcagaagtcatgtaatgttccatgtgtgtggtac
caagtaaaggttaatcaatgtggaaaaccaacacccacatcacgaggtatctacctaagg
gaggctaattcttgtcgacagaaaaccgaggtgagattccatggtcaatag

DBGET integrated database retrieval system