KEGG   Olea europaea var. sylvestris (wild olive): 111403823Help
Entry
111403823         CDS       T05244                                 

Definition
(RefSeq) raucaffricine-O-beta-D-glucosidase-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00460  Cyanoamino acid metabolism
oeu00500  Starch and sucrose metabolism
oeu00940  Phenylpropanoid biosynthesis
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111403823
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    111403823
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    111403823
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     111403823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 111403823
NCBI-ProteinID: XP_022888217
Position
11
AA seq 541 aa AA seqDB search
MNSGNDAAALTDFSSGSLEGGNKIKRSDFPSDFIFGSATSAYQVEGAWAAGGKSQSIWDV
FTMQTPGRIQGGANGCVAIDQYNRWKEDVALLKKVGLDSYRFSIAWSRVLPGGNLSAGIN
QEGIKYYNDLINLLLAEGIEPCVTIFHWDVPQYLEEEYGGFLSPRIVRDFGDFAELCFWE
FGDRVKYWITLNEPSSMAIQGYATGTFAPGRGPTSAEPVKAIPPHRCELKAPTPCPSGNP
GTEPYIVAHNMILSHAKAVDIYRKRYQAHQGGKIGITNVAQWYEPLTNSKADKEAASRAL
DFILGWFLAPIVTGDYPPVMRKLVGDRLPQFTQEQAKLVKGTYDFLGINYYTSIYASNSP
RQSGAAVSYSNDQDVSLSSDRDGTPIGPQAGSSWLSIVPNGIYKLLVYIKKTYNNPIIYI
TENGVDEVNNTALTVSDARFDETRIKFHQDHLFYIKKAMEEGVDVKAYFIWSMFDTFEWA
AGYSVRFGLFYVDYVNGYLTRFPKTSAIWLMNFLDKKRITLKRQAPEDEEEHGSAKKAKK
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtggcaacgatgcagctgcacttacggatttttccagcggcagtctggagggt
ggaaacaagataaagcgctctgattttccctcagattttatctttggttcggcaacatct
gcttatcaggttgaaggtgcttgggcagcaggaggaaaaagtcaaagcatctgggatgtc
ttcacaatgcaaacacctggtagaattcagggtggagctaatgggtgtgtagcaattgat
caatataataggtggaaggaagatgtggctttgttaaagaaagtgggtttagactcttac
agattttcaattgcatggtccagagtgttgccagggggaaacttatctgctgggataaac
caagaaggaatcaagtactataatgatcttataaacttgctcttggctgaaggcattgaa
ccctgtgtaactatcttccattgggatgttccccaatatttggaagaagagtacggtggc
ttcttgagccctcgaattgtgagagattttggtgactttgccgagctttgcttttgggaa
ttcggtgatcgggtaaagtattggatcactttgaatgaaccgtcgtccatggctattcaa
ggttatgcaacaggtacttttgcacctggtcgtggtccaacttcagcagagcctgtaaag
gctatccctcctcatagatgtgaacttaaggctccaactccttgccccagtggaaatcca
ggcacagaaccatatattgtggcacacaatatgatcctttctcatgcaaaagcggtagat
atctacaggaaaagatatcaggcacatcaaggaggcaagataggaataacaaatgttgct
cagtggtatgagccacttactaacagcaaagctgataaagaggctgcttcaagggccctc
gattttattttgggatggtttttagcaccaatagtaactggtgactacccaccagttatg
cgaaaactagttggagaccgtcttccccaatttacacaagaacaagctaagttggtgaaa
gggacttatgattttctgggcataaattattatacaagtatttatgctagcaattcacct
agacaaagtggtgcagcagtaagttactcaaatgaccaggatgtttcattatccagtgac
cgtgatgggacgcctattggcccacaggccggttcaagttggttgtctattgttccaaac
gggatatacaagctgttggtttatataaagaaaacatataataatcctattatatacata
acggagaacggggtggatgaagtaaacaatacggccctaacagtgtcagatgctcgattt
gatgagacaaggattaaatttcaccaggaccatctcttttatattaagaaagcaatggaa
gaaggtgtggatgtgaaggcttactttatatggtcaatgtttgatacttttgaatgggct
gctggatacagtgttagatttggccttttttacgtagattacgttaatggctatttgaca
agatttccaaaaacttctgctatatggctaatgaatttcttggacaagaagagaatcaca
ttgaagagacaagctccagaagatgaagaagagcatggctctgcgaagaaggctaagaag
cagtga

DBGET integrated database retrieval system