KEGG   Olea europaea var. sylvestris (wild olive): 111404214
Entry
111404214         CDS       T05244                                 

Definition
(RefSeq) beta-glucosidase
  KO
K22425  oleuropein beta-glucosidase [EC:3.2.1.206]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111404214
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.206  oleuropein beta-glucosidase
     111404214
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 111404214
NCBI-ProteinID: XP_022888763
Position
11
AA seq 568 aa
MHQSLQLTLLQRAPKSAMDIQSNVLTITSGSSPTDTSSNGQAAKSTKERIKRSDFPSDFV
FGAATASYQVEGAWNEGGKGMSNWDYFTQSQPGGISDFSNGTIAIDHFNMFKDDVVVMKK
LGLKAYRFSLSWPRILPGGRLCHGVSKEGVQFYNDLIDALLAADIEPYITIFHWDIPQCL
QLEYGGFLHERVVQDFIEYSEICFWEFGDRVKYWITLNEPWSFTVQGYVAGAFPPNRGVT
PKDTEETKKHARLHRGGGKLLAAFKYGNPGTEPYKVAHNLILCHAHAVDIYRTKYQESQG
GKIGITNCISWNEPLTDSQEDKDAATRGNDFMLGWFVEPVVTGEYPESMIKYVGDRLPKF
SEKEEKLVKGSYDFLGINYYTSTYTSDDPTKPTTDSYFTDSHTKTSHERNKVPIGAQAGS
DWLYIVPWGIYRVMVDMKKRYNDPVIYITENGVDEVNDKSKTSTEALKDDIRIHYHQEHL
YYLKLAMDQGVNLKGYFIWSLFDNFEWAAGFSVRFGVMYVDYANGRYTRLPKRSAVWWRN
FLTKPTAVPLKNEPEKSEDRRKRLRGST
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgcaccaaagtctgcaacttacactacttcaaagagcaccaaagtctgcaatggatatc
caaagcaacgtcctgacgattactagcggatcctcaccaactgacacttcctccaatggt
caggcagccaaatccaccaaagaaaggatcaaacgctctgattttcccagtgactttgta
tttggcgctgcaactgcttcatatcaagttgaaggtgcatggaacgaaggaggtaaaggc
atgagtaattgggattactttacacagagtcaaccaggtggtatttccgactttagcaat
ggcactattgcaattgatcactttaatatgttcaaggacgatgttgtcgtgatgaagaaa
ttgggtttgaaagcatacagattttcactttcatggcctagaatcttgccaggaggaaga
ctgtgtcacggtgtatctaaagaaggagttcagttctataacgatctcattgatgcactc
ttggcagctgacatagagccatatataactatctttcactgggatattccccaatgtttg
caactagagtatggtggcttcctacatgaaagagttgtgcaggattttattgagtattct
gagatttgcttctgggaatttggtgatcgggtgaaatattggattaccttgaatgagcca
tggtcctttactgttcaaggatatgtggctggtgcttttccgcccaatcgtggtgtaact
ccgaaagatactgaagaaactaaaaagcatgcccgtcttcatagaggtggaggaaaactt
ctagctgctttcaagtatggaaatcccggcacggaaccatataaagtggcacacaattta
atcctttgtcatgcacatgctgtggacatatacagaacgaaatatcaggaaagtcaggga
ggtaagatagggattacaaattgcattagttggaatgagcctcttactgactctcaagaa
gataaagatgctgctactagaggaaatgattttatgcttggatggtttgtggaaccagtg
gtaactggagagtacccagaaagtatgattaaatatgttggcgatcgccttcctaaattt
tctgaaaaagaggagaagctagtgaaaggatcctacgactttctaggcataaactactac
acgtctacttataccagcgatgatccaacaaagccgacaactgatagttactttactgat
tcgcacactaagacttcacatgaacgcaataaggtgcctattggtgcacaggctggttcg
gattggttatacatagttccatggggaatctacagagttatggttgatatgaagaaaaga
tataatgatccggttatttacattacagagaatggagtggatgaagtaaacgataagtcc
aagactagtaccgaagctctcaaggatgatataaggattcactatcaccaagaacatctc
tactaccttaagctagcgatggatcaaggtgtaaatttgaagggttacttcatatggtcg
ttgttcgacaattttgaatgggctgctggattcagtgttagatttggcgttatgtatgta
gactacgctaatggtcgttacacaaggttgccaaaacgttcagctgtatggtggaggaac
ttcctcaccaagcctacagcagttccattgaagaatgaacctgaaaaatctgaagatcgt
cgtaaaaggcttagaggcagcacctag

DBGET integrated database retrieval system