KEGG   Olea europaea var. sylvestris (wild olive): 111406125Help
Entry
111406125         CDS       T05244                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At1g51880
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111406125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase HMA
Motif
Other DBs
NCBI-GeneID: 111406125
NCBI-ProteinID: XP_022891111
Position
12
AA seq 668 aa AA seqDB search
MSNVYDHWERLVGAVIRREELWRMFHDQSPSVSSIPSDCSLDSQVLDVPFDFSSPRSSSS
YQQLPPSAVENLQKKEKSAEKEVSKLKLVIKVEVHDEKEKRKAMKAVSRLGGIESLAIDM
KEKKLTVVGGFDPVQVVSKLSKSWYTEILTVGPAKEPEKKKEEGKKDDANKGKNGKNRAP
LDWETRLRIALGAAKGIAHIHKQSSGKLVHGNIKSSNIFLNSQQYGCVSDLGLASMIQLP
VMRTAGHHAPEVKNTRNVSQASDVYSFGILVLELLTRKSPLHAIGDNEVLDLVKLVNSLN
GKERTADVFDVEISRNRNKEQRVKMLEIAMSCVAKNPSKRPKMDQVVKMMEVIWKMMEDI
TKSYERNQLQPKLVFNEGRNLDFGLEDLLRASAEVLGKGTFGTSYEATLDNGITIVVKTL
KDVIVTSKEFQQQMEVIGRMKNESVATLMAYYYSRDYKLVVYDYYGAGSVSSMLHGQFGK
GKISLDWETRLRIAVGAARGIAHIHSQVGQNLVHGNVKTSKYFLTAQGYGCVSDVGLATL
VSTTSVLHSRSSGYRAPEVVDTKKLSQASDVYSFGVVLLELHTGKPTILYEDNEKASQLV
RWVASVVREDWTAEVFDIELLRYQNIEKAMVEVLQIALYCVESVPKHRPKMSEVVSMLED
ISRRNSAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgtctacgaccactgggagagattggtgggagctgtgatccggagagaggaa
ctatggcgaatgtttcatgatcagagcccaagtgtcagctctataccatctgattgcagt
ttggattctcaagtccttgatgtgccttttgatttttcaagccctcgaagttcatcttcg
tatcagcagctacctccatccgcagttgaaaacttgcaaaagaaagaaaaatctgccgaa
aaggaggtttctaagctgaaactagtcataaaagtagaagtacatgatgagaaggagaaa
cggaaggccatgaaagcagtttctcgccttggagggatcgaatctctggctatagacatg
aaggagaagaaattaacagtagttggaggttttgatccagttcaagttgtgagcaaattg
agcaaatcatggtacacagaaattctaacggttggtccagcaaaagaacctgaaaagaaa
aaagaagaaggaaagaaggatgatgccaataaaggaaaaaatggcaagaatcgggctcca
ttagactgggaaacgcgactgagaattgcattgggtgcagcaaagggtatagcacacatt
cacaagcaaagtagtgggaagcttgtccatggaaacataaaatcatcaaacattttcctt
aattcacaacagtatggctgtgtgtctgatcttggcttggcaagcatgattcaattacca
gtcatgcgaactgctgggcaccatgccccagaagtcaagaacacccgaaatgtgtcccaa
gcgtctgacgtatatagctttggaatccttgtgcttgaacttctcactcgaaagtcccct
ttacacgccataggtgacaatgaggttctcgatctagtcaaattggttaattctctcaat
ggtaaggagcgaactgctgatgtgtttgatgtggagatctcgagaaaccgtaacaaggaa
caaagggtaaagatgttggaaatagcgatgagttgtgttgcaaaaaacccaagtaaaaga
cctaaaatggaccaagtagtgaagatgatggaggtcatttggaagatgatggaggacatt
actaagtcatatgaaagaaatcaactacaaccgaagcttgtatttaatgagggtcgtaat
cttgattttggccttgaagatttgttgcgggcttctgcagaggttctcgggaagggaaca
tttgggacttcatatgaggcaacattagataatggaattacaattgtggtaaagacattg
aaggatgttatcgttacgagtaaagaatttcagcaacaaatggaggtcattggaagaatg
aagaacgaaagtgttgctacattaatggcatactactactcgcgtgattataagcttgtg
gtgtatgattattatggtgcggggagtgtatcttccatgctacatggacaatttggcaag
ggtaaaatttctttagattgggaaactcgactaagaattgcagtaggggcagcaaggggt
attgctcacatccactcacaagttggccagaatcttgtacatggaaatgtaaaaacctca
aaatattttcttactgctcaaggatatggctgtgtttcagatgtcggattggcaacatta
gttagtacaacctcggtgctacatagtcgttcatcagggtatcgcgccccagaagtcgtg
gataccaagaaattgtcccaagcttctgatgtctatagcttcggcgtcgtgcttctcgaa
cttcatactggaaagccaactatactttatgaagataatgaaaaggccagtcagctagtg
aggtgggttgcttctgttgttcgtgaggattggactgcagaagtgttcgatatcgagttg
ttgaggtatcaaaatatagagaaagcaatggtggaggttttgcagatagcgttgtattgt
gttgaaagtgttcccaagcatagaccaaaaatgtcagaggtagtgagtatgttagaggat
atcagccgaagaaactcggcagcctag

DBGET integrated database retrieval system