KEGG   Olea europaea var. sylvestris (wild olive): 111407351Help
Entry
111407351         CDS       T05244                                 

Definition
(RefSeq) receptor-like protein kinase HERK 1
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 111407351
NCBI-ProteinID: XP_022892542
Position
13
AA seq 800 aa AA seqDB search
MKIHTFLLFISILKCTCQEFDPPDNYLIDCGSTENTRVDDRPFLADNLNSSILSTPEIIF
VKTSDSPSSIYNSSLYKTARILNGSSNYSFPMKQRDWHLIRLHFFSFVSETFDLSSAKFS
VSAQKFILLKSFRPPHGPVVKEYSVNVTTDNLVLTFTPSPGSFAFLNALEIISLPGQVIP
DGTPAVNSQQPYTSVEAQALETVWRVNMGNETVFPRNDKLSRYWLSDRERLINSNLVEFV
SNVQAVNETRGYSEFIAPRSVYGTATKLHSQPDPNTIINVTWSFGVDNGFDYVIRFHFCD
IANRSPGPLIFNVFLNSGVALRDLDLSSKTSNVLGAPYYVDVITRINDIHNLSVSIGSSS
VKNAYPDGILNGLEIMKISNSKGSLDPADAEAQTTKPASKTKVWLIVGLAIGSLLIFIVL
AFLLVVMIRRRRRDNAVHSGEDHSIIMNQESSENSKYPQIGYRFPLMAVQEATDNFSENL
LIGIGGFGKVYKGSLKDNTTFAVKRGICQSQQGHKDFRNEIEMLSQFRHRHLVSLIGYCD
EKDEMIIIYEYMENGTLRDHLYGTNLPKLNWKQRLEICIGSARGIHYLHTGSANAIIHRD
VKSANILLDENMKAKVGDFGISKTGPEIDQTHVSTAVKGSFGYLDPEYLATRKLTEKSDV
YSFGVVMLEVICGRPVIDPSLPREMVNLIEWALKWLSRGRLDKILDPHLVDEIEQESMQK
FGETAEKCLAEQVGDRPSMGDVLWNLENALQILENHQRLKERNEVEQSVSIAQYSMGSLG
DLENVPMSKVFSKMVKAEIS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatacatttctgttgttcatttctattctgaaatgcacttgtcaagaattt
gatcctccagataactatctaatagactgtgggtcgacagaaaatacacgagtagatgat
cggcctttcttggctgataacttgaattctagcattctgtcaaccccagaaatcattttt
gtcaaaacttcagattctccttcatccatttataattcatctctgtacaaaactgccaga
attttgaatggttcctcaaattacagctttccaatgaagcaaagggattggcacttgatt
cgtttgcactttttttcttttgtcagtgaaacgtttgatctttcaagtgctaaattttct
gtttctgctcaaaaatttattcttttaaagagctttcgaccaccacatggtccggttgtc
aaggaatactccgtcaatgtaactactgataatctagtccttacctttactccttctccc
ggttcatttgcatttttaaatgctttggaaatcatttcacttcccggtcaggttatcccg
gatggcactcctgctgtaaattctcaacagccttataccagtgtggaggcacaagcacta
gaaacagtttggagagtgaatatggggaatgagactgtgttccctcggaatgataaatta
tcgcgttattggctgtctgatagagagcgtttgatcaatagtaatcttgttgagttcgtg
tcaaatgttcaggctgtaaatgagacgaggggatatagtgaatttattgctcctcgttct
gtctatggtactgccactaagctgcattcacagcctgatccgaacactataattaatgta
acttggtcatttggtgttgataatggttttgattatgttatccggtttcatttttgcgat
atagcaaaccgtagtcctggtcctcttatcttcaatgtttttctcaattctggagtggct
cttagagatctagatctcagcagtaagacatcaaatgttttgggagctccatattatgtg
gatgtcatcactagaataaacgatatacacaatcttagcgtaagtattggtagttcatct
gtgaaaaatgcatatcctgatggaattcttaatggactcgagatcatgaagataagcaat
tctaagggcagtcttgatcctgcagatgctgaggcccagacgactaaaccggcttccaag
actaaagtgtggttgattgtggggttggctattggatcattgttgattttcattgttttg
gcatttcttttggttgtgatgatcagacgaagaagaagggacaacgccgttcactcagga
gaggaccattctatcataatgaatcaagaaagttctgagaatagtaaatatccccaaata
ggttaccggttccctctcatggcagttcaagaagcaacagataattttagtgaaaatctg
cttattggtattggaggttttgggaaagtctacaagggatctttgaaggataacacaacg
tttgcagtgaagagaggaatttgtcaatctcagcagggccataaagattttaggaatgaa
atcgaaatgttatctcaatttcgtcatcgccatttagtttctttaataggatactgtgac
gagaaggatgaaatgatcataatctatgagtacatggagaatggtacccttagggatcat
ctttatggaacaaatcttccaaaattgaattggaaacagaggcttgaaatctgcattgga
tcagcaagagggattcactatttgcatacaggttctgctaacgcgatcattcatcgcgat
gtgaagtctgcaaatatacttcttgacgagaatatgaaggccaaagttggtgatttcgga
atttcaaaaactggtccggagatagaccaaacacatgttagtacagcagtaaaaggaagt
tttggttatctcgatcctgaatatttggcaacacgaaagctcactgagaaatctgatgtc
tactcttttggtgtagttatgctcgaagtcatctgtgggaggccagttattgatccatca
cttccaagggaaatggtaaatttaattgaatgggcactgaaatggctaagccgaggaagg
ttggacaaaattttagaccctcatcttgtcgatgaaattgaacaggagtcgatgcaaaaa
tttggggagacggctgagaaatgcttggccgagcaggttggtgacagaccatcaatggga
gacgtattgtggaatttggaaaatgcccttcagattctggaaaatcatcagagactaaag
gaaaggaatgaagtggagcagagtgtgtccattgcacaatacagcatgggaagtttaggc
gaccttgagaatgttccaatgagtaaggttttctcgaaaatggtgaaggccgaaatcagt
taa

DBGET integrated database retrieval system