KEGG   Olea europaea var. sylvestris (wild olive): 111409286Help
Entry
111409286         CDS       T05244                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00030  Pentose phosphate pathway
oeu00480  Glutathione metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
oeu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111409286
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111409286
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oeu04147]
    111409286
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     111409286
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     111409286
Exosome [BR:oeu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   111409286
  Exosomal proteins of colorectal cancer cells
   111409286
  Exosomal proteins of bladder cancer cells
   111409286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 111409286
NCBI-ProteinID: XP_022895073
Position
14
AA seq 513 aa AA seqDB search
MASGEWHCEKRDLLKNESFTKESGNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF
LQSNEVHIFGYARTKISDDELRNRIRGYLSTGNEGSEDVSKFLQLIKYVCGSYDAEEGFL
ALDKAISEHETSKNSSEGSSRRLFYLALPPSVYPQVCKMIKNYCTNKSDLGGWTRIVVEK
PFGKDLASAEELSSQIGELFDEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNID
NVQIVFREDFGTEGRGGYFDQYGIIRDIIQNHLLQVLCLVAMEKPISLKPENIRDEKVKV
LQSVVPIKDEEVVLGQYDGYRDDPTVPDNSNTPTFATMVLRIHNERWEGVPFILKAGKAL
NSRKAEIRVQFKDVPGDIFKCKKQGRNEFVIRLQPSEAIYMKLTVKQPGLDMSTAQSELD
LSYRQRYQGVVIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLLHQIDNGEFKPIS
YKPGSRGPAEADELLERAGYVQTHGYIWIPPTL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggggaatggcactgtgagaaacgagatcttctaaagaacgaatcttttacg
aaagagagtggtaatgtgccggaaactgggtgtctctccatcattgttctcggtgcttcg
ggtgatcttgccaagaaaaagacttttcctgcgctttttaacctttatcgtcagggattt
ttgcaatcaaacgaagttcacatttttggctatgcgaggaccaaaatttcagatgatgaa
ttaagaaatcgtatacgagggtacctttctacaggaaatgaaggctcagaagacgtgtcg
aagtttcttcagttgattaaatatgtatgtggctcttatgatgctgaggagggatttctg
gcattggacaaggcaatatctgagcatgaaacatcaaaaaacagctcagagggatcgtct
agaaggctcttctacctcgcacttcctccgtcagtatatcctcaagtctgcaaaatgatc
aagaattattgcacaaataaatctgatctcggtggatggacccgtattgttgttgagaag
ccctttggcaaggatttggcttcagctgaggaactaagctctcagattggagaattattt
gatgaaccacagatttatcgcatagatcactatttgggcaaggaattggtccagaacttg
ttggtacttcgttttgcgaatcgcttctttttgccactctggaatcgtgacaatattgat
aacgtacagattgtcttcagagaagattttggaaccgaaggtcgtggtggatattttgat
caatatggaattatcagggacatcattcaaaatcacctcttgcaggttctttgcctagtt
gctatggagaagcccatttctctgaagcccgagaatataagagacgagaaagttaaggtt
ctccaatcagtggttccgatcaaagatgaagaggtggttcttggacaatatgatggttat
agggatgacccgacagttcccgacaactcaaacacccctacttttgcaactatggttctt
agaatacataatgaaagatgggaaggtgtaccttttatacttaaggcaggcaaggcccta
aactcgagaaaagcagagattcgggtacaatttaaagatgttccgggtgacattttcaaa
tgtaaaaagcaagggagaaatgaatttgtaatacgtctgcaaccttcagaggccatttac
atgaaacttacggtcaagcagcctgggctggatatgtcgactgctcagagtgaactagat
ttgtcataccgacaacggtatcagggggttgtcattcccgaggcttatgaacgtctaatt
cttgacacaatccgtggtgatcagcagcattttgttcgtagagacgagcttaaggctgcc
tgggagattttcacacctcttttgcaccaaatagacaatggtgagtttaagccaatttca
tataagccgggcagcagaggcccagcagaagcagacgagttgctggaaagggctggttat
gttcaaacacatggctacatttggatccccccgaccttgtaa

DBGET integrated database retrieval system