KEGG   Olea europaea var. sylvestris (wild olive): 111409798Help
Entry
111409798         CDS       T05244                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00350  Tyrosine metabolism
oeu01100  Metabolic pathways
Module
oeu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111409798
Enzymes [BR:oeu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     111409798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 111409798
NCBI-ProteinID: XP_022895612
Position
15
AA seq 225 aa AA seqDB search
MASGTGEVSKKLKLYSYWRSSCSCRVRIALKLKGLDYEYIAINLLKGDQKSPEFLKLNPL
GYVPVLVDGDFVVADSFAILLYLEEKYPQHPLLPKDLQKRALNYQAANLISANIQPLRNL
LVLGYIQEKLGPDEKIPWGQTHIRKGFAALEKLLENYAGKYATGNEVFLADLFLAPQIDG
AVRRFNVDMSEYPILSRINEAYKELPAFQDAMPGKQPDTPPEARA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtggaactggtgaggtttcaaagaagctgaagctctattcctattggcggagc
tcttgttcttgccgcgttcgaatcgctctcaaattaaaagggctagattatgagtatatt
gcaattaacttgctcaaaggggaccagaaatctccagagtttttgaagcttaatccactt
ggatatgtgccagtacttgtggatggtgactttgtagttgcagactcttttgctatatta
ctgtatctagaagagaagtatcctcagcatccattgttgccaaaagatcttcagaaaagg
gctctcaattaccaggctgcaaatttgatttctgcaaacatacaacctctccggaattta
cttgtcctcggctatattcaagaaaaacttggtcctgacgagaaaattccttggggtcaa
actcatatacgaaaaggctttgctgctctggagaagctattagaaaattacgctggaaaa
tatgccacggggaatgaagttttcctggctgatttgtttctggcaccccagattgatggt
gcagtcagaagattcaatgttgacatgagtgaatatcctatcctatcgaggattaacgag
gcgtacaaagaactccctgcttttcaagatgctatgccaggaaagcaacctgatacacca
ccagaggctagagcctga

DBGET integrated database retrieval system