KEGG   Olea europaea var. sylvestris (wild olive): 111412252Help
Entry
111412252         CDS       T05244                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00350  Tyrosine metabolism
oeu00360  Phenylalanine metabolism
oeu00380  Tryptophan metabolism
oeu00950  Isoquinoline alkaloid biosynthesis
oeu00965  Betalain biosynthesis
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111412252
   00360 Phenylalanine metabolism
    111412252
   00380 Tryptophan metabolism
    111412252
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    111412252
   00950 Isoquinoline alkaloid biosynthesis
    111412252
   00965 Betalain biosynthesis
    111412252
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oeu04147]
    111412252
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     111412252
    4.1.1.105  L-tryptophan decarboxylase
     111412252
Exosome [BR:oeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111412252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 111412252
NCBI-ProteinID: XP_022898870
Position
16
AA seq 506 aa AA seqDB search
MGSLQNQKPENGFNSTIKPLDPEEFRKQGHMVIDFLADYYKNVEKYPVRSQVEPGYLRKR
LPESAPDDPEPIEEILQDVQKDIVPGITHWQSPNYFAYFPSSGSIAGFLGEMLSTGFNVV
GFNWMSSPAATELESIVMDWLGKMLKLPNEFLFSGGGGGVLQGTTCEAILCTIVAARDQI
LKKIGRDNINKLVVYGSDQTHSAVQKAAQIAGIKPNNFRAVSTTKANAFGLTAEALRSTI
KADFEAGLFPLFLCATIGTTSSTAVDQLSPLCEVANEYGIWVHVDAAYAGSACICPEFRH
FLDGVENSHSFSFNAHKWFFTTLDCCCLWVKDPSALVKALSTYPEYLRNKASETKQVVDY
KDWQITLSRRFRSLKLWLVLRSYGVAKLRKLLRSHVKMAKNFEGLIGMDKRFEVVVPRNF
ATVCFRISPIEIGKNLNVTKDEATNEFNSKLLESINESGKIYMTHAVIGGVYVMRFAVGA
SLTENRHVHLAWKVVQEHANALLKMS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggaagccttcagaaccaaaaaccagaaaatggcttcaactccaccattaaacctcta
gaccctgaagagttcagaaaacaaggccacatggtcattgacttcctggctgattattac
aaaaatgttgagaaatatccagttcgaagccaagtcgaaccgggctatctccggaagcgg
ttacccgagtccgctcccgacgatcccgaacctattgaagaaattctacaagatgtacag
aaagatatcgttcctggtatcacacattggcaaagtccaaattactttgcttattttcca
tccagtggtagcattgcaggatttctcggggaaatgcttagcactggattcaatgttgtt
ggattcaactggatgtcctcgcctgctgcaactgagctcgagagtattgtgatggattgg
ctggggaaaatgcttaagcttcccaatgaattcctgttttccggcggcggcggtggagtt
ttgcagggcaccacctgcgaggccatcttgtgcactattgttgccgccagggatcagata
ttgaagaagatcggcagagataatattaacaaacttgtggtgtacggatccgatcaaacc
cactctgcagtgcaaaaggctgctcaaattgctggtatcaagcccaacaatttccgagca
gtctcgactacaaaggccaatgcatttgggctcactgcagaagcactccggtcgaccatc
aaagccgacttcgaagccgggctatttccattattcctctgtgccaccatcggaaccaca
tcatcgactgcagttgatcaactgagtccactctgtgaagttgccaatgagtacggaatt
tgggttcacgtagatgctgcatatgcaggaagtgcatgcatatgcccggagtttcgccat
tttctagatggcgtcgaaaattctcattcttttagcttcaacgcacacaaatggttcttc
actactctcgactgttgctgcctatgggtgaaggatcccagcgccctggttaaagctcta
tcgacctatccagagtacttgaggaacaaagcctcggaaacaaagcaggtggtggattac
aaagactggcaaatcactttgagccgacgatttcgatccctgaaactgtggctcgtgcta
cgtagttacggtgtcgccaaactgagaaagttattaagaagtcacgtaaaaatggcaaag
aatttcgagggactcataggcatggacaagaggtttgaagttgtagtccctagaaatttc
gcgacggtctgtttcagaatttcaccgatagaaatcggaaagaatctgaatgtcaccaag
gatgaagctacaaatgaattcaactccaagctactagagtccatcaatgagtcaggtaag
atatacatgacccacgctgtgataggaggtgtttacgtgatgcgattcgcagtcggtgcg
agcctcacagaaaacaggcacgtccacttggcctggaaggttgtgcaagaacatgcaaat
gccctactcaaaatgtcatga

DBGET integrated database retrieval system