KEGG   Olea europaea var. sylvestris (wild olive): 111412755
Entry
111412755         CDS       T05244                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00100  Steroid biosynthesis
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Module
oeu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111412755
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111412755
SSDB
Motif
Pfam: ERG4_ERG24 OPA3
Other DBs
NCBI-GeneID: 111412755
NCBI-ProteinID: XP_022899441
Position
2
AA seq 201 aa
MDLDSLISSLLPSWTSVAMLLSFFTYLGISGSILPGRIIPGVTLSDGTRLHYRCNGMLLL
LLLVLSLGAAAGIDLVSPSAIADRGLELLSTTFIFSVFVTLILYLTGRQSRNQSSSLKPH
VTGNLINDWWFGIQLNPQFIGMDLKFFFVRAGMMGWLLINLSVLAKCIQEGILSRSMIFY
QLFCFLYILDYFFHEEYMTST
NT seq 606 nt   +upstreamnt  +downstreamnt
atggatctcgattcacttatcagttctctccttccgtcatggacttcggttgctatgctg
ctatcattctttacttacttgggaatctccggatctattttaccgggaagaattattcct
ggggtgactttatcagatggcactcgactccattaccgttgcaatggtatgttattgctt
ctgttgttagttttgtcacttggagctgctgcggggatagatctcgtgtcaccctcggca
attgcagatagagggcttgagcttttgtcaacgacatttatattcagtgtgtttgtgact
ttgatactctatttgactggccgtcaatcccgcaaccaaagttcttcgctgaagccccat
gttacaggaaacttgatcaatgactggtggtttggaatacagctgaatcctcaattcatt
ggcatggacctcaaattcttctttgttagagctggaatgatgggatggcttcttataaat
ctttccgttcttgcaaaatgtattcaagagggcatcttaagcagatcgatgattttttac
cagcttttctgttttctctatattttggactactttttccatgaagagtacatgacctcc
acgtaa

DBGET integrated database retrieval system