KEGG   Oxalobacter formigenes: BRW83_0661Help
Entry
BRW83_0661        CDS       T04835                                 

Gene name
rluD
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ofo  Oxalobacter formigenes
Brite
KEGG Orthology (KO) [BR:ofo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ofo03009]
    BRW83_0661 (rluD)
Enzymes [BR:ofo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BRW83_0661 (rluD)
Ribosome biogenesis [BR:ofo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BRW83_0661 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ARQ45423
Position
691176..692204
Genome map
AA seq 342 aa AA seqDB search
MTENEKSNIPELFQIESDEEEILTEQEPIRFVLSLKDGGQRLDKLVAGRLSQYSRSRLQR
WIEDGHITVNGEKAQAKQTVIGDEEICVIPQLAEEDLAFTPEAVDFPVVFEDNAILVVNK
PASLVVHPAAGNWSGTLLNGLLYRDPKSATVPRAGIVHRLDKETSGVMVVAKTIEAQTDL
VRQLQARTVKREYLALVWGDTPQSGTIDEPIGRHPRDRVKMAVIHTQSGKPAVTHFRKIA
EGVCNNMNVSLVKCRLETGRTHQIRVHLQSIGFPLVGDPVYGKSHLASVFPRQALHAFRL
GLIHPCTKEVCEWTAPLPQDMKALLEQSFIEENGKWYESDYS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaaaatgaaaagtcaaatatccccgaactttttcaaattgaatccgacgaagag
gagatattaacagaacaagagccgataaggtttgttttatcgttgaaagacggcggccag
cgtctggataaactcgtggcagggcggctttcccaatattcccgcagccggcttcaacgc
tggatagaagatggacatatcacagtaaacggggaaaaggcacaggcaaaacagaccgtg
atcggcgatgaggaaatttgtgtcatcccgcaactggccgaggaagatctggcttttaca
ccggaggcggtcgactttcctgtcgtgtttgaagacaacgccatactggtcgtcaacaaa
ccggcgtctctggtcgttcatccggcggccggaaactggtcaggcacgcttttgaatgga
ttgctgtatcgtgatccgaaaagcgcaacggttccaagggcagggatcgtccatcgtctg
gacaaggagacgagtggtgtcatggtcgttgccaaaacaatcgaggcgcaaaccgatctg
gtcaggcaattgcaggccagaaccgtaaaaagggaatatctggcgctggtctggggcgat
accccgcagtccggtacgattgacgaaccgatcgggcggcatccaagggaccgggtcaaa
atggctgtcatccatacgcaatcaggaaaacctgcggtaacccatttcagaaaaatagcc
gaaggcgtttgcaataacatgaatgtcagtctggtcaaatgcaggctggaaaccggtcgt
acacatcagatcagggttcatctccagtcgatcggttttcctctggtgggtgatccggtt
tatggcaaatcccatttggcctctgtatttccgaggcaggcattgcatgcgttccggctg
gggctgattcatccgtgcacaaaagaggtatgtgaatggacagcgccattgccacaggac
atgaaagcattgctggaacagtcttttatcgaagaaaacgggaaatggtatgaatctgat
tattcctga

DBGET integrated database retrieval system