KEGG   Owenweeksia hongkongensis: Oweho_0709Help
Entry
Oweho_0709        CDS       T01677                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00220  Arginine biosynthesis
oho00330  Arginine and proline metabolism
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01130  Biosynthesis of antibiotics
oho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oho00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Oweho_0709
   00330 Arginine and proline metabolism
    Oweho_0709
Enzymes [BR:oho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Oweho_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Virulence_fact
Motif
Other DBs
NCBI-ProteinID: AEV31723
UniProt: G8R1I4
Position
complement(745884..746834)
Genome map
AA seq 316 aa AA seqDB search
MAKKLQFLSIMSELGAGTRGASLGFPALEIASLKYDPEFFPKYSIKEVETDNNLVFKKKT
LKFGKRLDGIARMYRNIQDEVAATFNDKKFPVVFSGDHSNAGGTIAGIKAAYPTKRLGVI
WVDAHGDLHSPYTSPTGNVHGMPLATALHEDNLENKNNDPQEETIWYWNEMKGSNQRVKH
SDLFFVGLRDLEQPEINLMTKHNIPNVTVDELREMGVKAVAEKALIYLKDCDIIYISFDV
DSMDPSVSRGTGTPVEHGLTEDEARDLLLHLVEDERLCCFETTEVNPLLDDKGNSMAEAA
FRVIKPVIEKIESNLK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagctacaatttttaagtatcatgtctgagcttggtgctggaaccagaggt
gcgagtcttggttttccggccttggaaatagctagtctaaagtatgacccagagtttttt
ccgaagtattctattaaagaagtagagacggataacaacttggtcttcaaaaagaaaact
ttaaaatttgggaaacgactggacggtattgctcgcatgtaccgaaatattcaggacgag
gtagctgccacttttaatgataagaagtttcctgttgttttttctggtgatcacagtaat
gcagggggaactatcgcaggcataaaagcggcttatccaaccaagcgtcttggtgtgatt
tgggtagatgctcatggcgaccttcactcaccatacaccagccctactggtaatgtacac
ggcatgccattggcaactgctcttcatgaagacaatcttgaaaataagaataacgaccct
caagaggaaaccatttggtactggaatgaaatgaagggtagtaatcagcgcgtgaagcac
agcgatcttttctttgtaggattgcgtgatttggaacagccggaaattaatttaatgact
aagcataatattccaaatgtaaccgtggatgaacttcgcgaaatgggtgtgaaagctgtg
gctgaaaaggcactaatctatctgaaagactgtgatatcatttatatttcttttgatgta
gacagtatggatcctagtgtgagtagaggcacagggactccggtggagcacggtcttact
gaagatgaagctcgagacctcttactacatcttgtagaagatgagcgtctttgctgcttt
gaaactaccgaagtgaatcctttgcttgatgataaaggaaactccatggccgaagccgct
tttagagtgataaagccagtaattgaaaaaatagaatccaacttaaagtaa

DBGET integrated database retrieval system