KEGG   Owenweeksia hongkongensis: Oweho_3471Help
Entry
Oweho_3471        CDS       T01677                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase (vermilion)
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00380  Tryptophan metabolism
oho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Oweho_3471
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     Oweho_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase CdvA Ist1
Motif
Other DBs
NCBI-ProteinID: AEV34420
UniProt: G8R6F7
Position
3883093..3884007
Genome map
AA seq 304 aa AA seqDB search
MSDVNDRIDEKYRNLGENPETYKEGLFLSKPLTYWDYIQVDTLLSLQKPRTDYEDEKIFV
IYHQVTELMQELVLHELRQITGPMPVTGEKLAEKVKRMIRYTRMLITSFDVMREGMDYDD
YNTFHKALAPASGFQSANFRYIELRCTSLPNLVNSRGKKRLPLRPTIDDFFDNLYWKDAG
LNRETYEASLTYTLFMEKYGENLKKLAREMQGNTLEDKVNARLETCSQETRELLREFDKL
YNIEWPLVHLRTAAHYLDAKGETKAATGGSEWKKYLHPMYQQRKFFPSLYSEEELENWGK
DYKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtgaatgacagaatagacgagaaatatcgtaacctgggagagaatcctgaa
acctataaagaaggactatttctatctaaaccacttacatattgggattatatacaggta
gatactttactgtcattacaaaagccgagaactgattatgaagatgaaaagatattcgtc
atctatcatcaggtaactgagttaatgcaagaattggtgctgcatgagcttaggcaaatc
actggcccaatgcctgtaacaggtgaaaagctggcagaaaaagtaaagcgcatgattcgc
tacacgcgtatgctcattacttcttttgacgtgatgcgcgaagggatggattatgatgat
tacaatacatttcacaaagctttagccccagccagtggttttcaaagtgcaaattttaga
tacatagaacttcgctgcacatcactgcctaatttggttaattcaagaggtaaaaagcgt
ttgccgctccgtcctactatagatgacttttttgacaacctatattggaaagatgcaggt
ttgaatcgtgaaacttatgaagcgagccttacttacacactttttatggagaagtatggt
gagaacttgaaaaaactggctcgcgaaatgcaaggcaacaccttagaagataaggtaaat
gcccgccttgaaacttgctcacaggagactcgtgagttgctgcgcgaatttgataaacta
tataatatagaatggcctttggtacacttgcgtaccgcagcacattatttggatgcaaaa
ggcgaaactaaggctgcaactggtggcagcgagtggaaaaagtatctacaccctatgtat
cagcaacgcaagttttttcctagcctgtatagtgaggaggagctagaaaactgggggaaa
gattataaaatctag

DBGET integrated database retrieval system