KEGG   Oceanobacillus iheyensis: OB3476
Entry
OB3476            CDS       T00093                                 
Name
(GenBank) transcriptional repressor (LacI family)
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
oih  Oceanobacillus iheyensis
Brite
KEGG Orthology (KO) [BR:oih00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oih03000]
    OB3476
Transcription factors [BR:oih03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    OB3476
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 DUF1835 Trp_repressor
Other DBs
NCBI-ProteinID: BAC15432
JAMSTEC: OB3476
UniProt: Q8EKV6
Position
complement(3611980..3612963)
AA seq 327 aa
MTTILEVAKKAGVSVATVSRVLNNRHQVREVTRSKVEQAIVALNYEPSVLGRNLRNSESR
LLLVLIPSIANPFYTEIINGIEDSAIKEGYNIMLCETDSNPQREAIYFNLVRNRMADGII
LMDPTINRNNVLQLANQHPIVQCSEFDKDGLISYVSINNELAAYQAVKHLIKIGRQRIAL
INSEEKFLYARERRAGYERAFREYGRSVNPSYIYNINGLSFENGQQAMRMLLEQKEKPDA
VFAVSDIFAIGALKEIHEVGLSVPEEIAIIGFDKISFSNMTYPTLTTIAQPMYRMGSISA
EMIIAKIRGEKVESRLLEHELIIREST
NT seq 984 nt   +upstreamnt  +downstreamnt
ttgacaacgattctagaagtagcaaaaaaagctggtgtttctgtagcaactgtttctcgc
gtccttaataatcgtcatcaagtgagagaagtgactcgatcaaaagttgagcaagcgatt
gtagcgttgaattatgagccaagtgtcttaggtagaaatttacgtaattcagaaagtcgc
ttattattagttcttattcctagtatcgccaacccattttacacagaaattattaatgga
attgaagattctgcgattaaagaaggatataacattatgctatgcgagacggactctaat
ccacaacgagaagcaatttattttaacctagttcgaaatcgaatggctgatgggattatt
ttaatggatcctacgattaatcggaataatgtattacagctagcaaatcaacatccaata
gtacagtgtagtgaatttgataaggacggattaatttcctatgtatccatcaataatgaa
ttagctgcttatcaagcagtaaaacatttaattaaaattggtagacaaagaatcgccctt
ataaactcagaggaaaaatttttgtatgccagagaacgtcgagctgggtatgaaagggct
tttcgagaatatggtcgatctgtcaatcccagttatatctataatataaacggtttaagc
tttgaaaatggacaacaagcgatgcgaatgctgttggagcaaaaagaaaagccagatgcc
gtttttgctgtatcagatatttttgcaataggtgcattgaaagagatacatgaggttggt
ctttctgttccagaagaaattgccattatagggtttgataagattagtttttctaatatg
acatatcccacattaacgacaatagctcaaccgatgtaccgcatgggaagtatatccgca
gagatgataatcgcaaaaattcgtggagagaaggtagaaagtcgtttattagaacatgaa
ttaattattcgagagtctacatag

DBGET integrated database retrieval system