KEGG   Oceanobacillus iheyensis: OB0492Help
Entry
OB0492            CDS       T00093                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD)
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00620  Pyruvate metabolism
oih00630  Glyoxylate and dicarboxylate metabolism
oih01100  Metabolic pathways
oih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OB0492
   00630 Glyoxylate and dicarboxylate metabolism
    OB0492
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     OB0492
    1.2.1.22  lactaldehyde dehydrogenase
     OB0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: BAC12448
JAMSTEC: OB0492
UniProt: Q8ESX4
Position
complement(522281..523735)
Genome map
AA seq 484 aa AA seqDB search
MAELKAITTYQMYINGEFVNASNNETLEVTNPATEEIVSTVPKASLEDTRRAIDGSAKAQ
KDWANLPSSKRASYLFAISKEIRSNIDEYAKIISEEMGKPLDQAVVEVSVTADYFEYIAG
WARKYEGEIVPSDREKENILVFKQPIGVVAGILPWNFPFFLIARKAAPAILTGNTIVLKP
SSVSPNNALAFAKILDKVGLPKGVINIVTGAGSIVGEELSKNEKIGMISLTGSTEAGSRV
MEKASKNITKVSLELGGKAPSIVMEDADIDLAVKSVLDSRIINTGQVCNCTERVYVHEDV
ADEFIEKITKAMSNVSYGNPLGNEQIDMGPLSNEAGLKNVEDMVKRAVENGATVLTGGNR
VNTEAGYYYEPTVLSNVDNSFEIMKEEVFGPVLPIATFTSLDEAIELANDCQYGLTSAIF
TNNVNYMMRASNELEFGETYVNRESFEAIQGFHAGWKKSGIGGADGKHGLGEFLQTHVVY
IQYK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattgaaagcgataacaacatatcaaatgtacattaacggagagtttgtcaat
gctagtaacaatgaaacacttgaggttacaaatcctgcaacagaggaaatagtttcaaca
gttccaaaagctagcttagaagatactagaagagcaatcgatggttctgcaaaagcgcaa
aaagactgggcaaaccttccttcaagtaaacgagcatcttatctattcgcaataagtaaa
gagattcgatcaaacattgatgaatatgcaaagattatttctgaggaaatgggaaaaccg
cttgatcaagctgttgtagaagttagtgttactgctgactactttgaatatattgctggt
tgggcaagaaaatatgaaggtgaaatcgtaccaagtgacagagaaaaagaaaacatcctt
gtattcaaacaaccaattggtgttgtagccggtatattaccttggaattttccgttcttc
ttaattgcacgaaaagctgcacctgctatattaactggaaatactatagtgctcaaacca
agtagtgtttctcctaataatgcgttagcttttgctaagattttagataaagtcggatta
ccaaaaggtgttattaatatagttactggtgcaggtagcattgttggtgaagaattatct
aaaaacgaaaaaatcggaatgatcagcttaacaggaagcacagaggctggatcaagagta
atggagaaagcatcgaaaaacatcacaaaagtgtctcttgagttaggaggcaaagcgcct
tcgattgtgatggaagatgcagatattgacttggctgtaaaatccgttcttgattctcga
atcatcaatacaggacaggtttgtaactgtacagaaagagtttatgtacatgaagatgta
gctgatgaatttattgaaaaaatcacaaaagcaatgtccaatgttagttatggaaatcct
cttggaaatgaacaaatcgatatgggaccactttcaaatgaagcaggtcttaaaaatgta
gaagatatggttaagcgcgcagtagaaaatggagcaactgtattaacaggtggaaaccga
gtgaacacagaggctggatactattatgaacctactgtactatcaaatgtcgataatagc
tttgaaattatgaaagaagaagtgttcgggcctgtattacctattgctacttttacttca
ttggatgaagcaatcgaattagcaaatgactgccaatatggattaacatctgctattttt
acaaataacgtgaattacatgatgcgcgctagtaatgaattagaattcggagaaacctat
gttaatagagaaagcttcgaagcaattcaaggattccatgctggttggaaaaaatcagga
attggcggagcagacggaaaacatgggttaggagaatttctacaaactcatgttgtctac
attcaatataaataa

DBGET integrated database retrieval system