KEGG   Oceanobacillus iheyensis: OB0570Help
Entry
OB0570            CDS       T00093                                 

Definition
(GenBank) gluthatione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00480  Glutathione metabolism
oih00590  Arachidonic acid metabolism
oih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    OB0570
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OB0570
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OB0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF823
Motif
Other DBs
NCBI-ProteinID: BAC12526
JAMSTEC: OB0570
UniProt: Q8ESQ1
Position
complement(599592..600068)
Genome map
AA seq 158 aa AA seqDB search
MSVHDFTVTTIEGEEKRLSDYKGKVILIVNTASQCGFTPQLEDLQKLYKQYQDNDFEILG
FPCNQFGNQDPGASEEISAFCQKNYGVTFQMFKKVDVKGKEAHPLYKHLTEEKKGILGGQ
IKWNFTKFLIDQNGNVIERFSPQKNPNTLNKDIEVLLR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacatgattttacagtaactaccattgaaggggaagaaaaaagactttccgat
tataaaggtaaagtgatattaattgtgaatactgcaagtcaatgtggctttaccccacag
ttagaagatctccaaaaactatataaacaatatcaagataatgattttgaaatattaggg
tttccgtgtaaccagtttggtaatcaagatcctggagcatcagaggaaatttcagcattc
tgtcaaaagaactatggagtaacttttcaaatgtttaaaaaagttgatgtgaaaggtaaa
gaagcccatccgctctataagcacctaaccgaagagaagaaaggaatactaggtggacaa
atcaaatggaatttcacgaagttccttattgatcaaaatggaaatgttatagaacgtttt
tctccccaaaagaaccccaatacgttaaataaagatattgaagttttgttacgataa

DBGET integrated database retrieval system