KEGG   Oceanobacillus iheyensis: OB0765Help
Entry
OB0765            CDS       T00093                                 

Definition
(GenBank) glutamyl-tRNA (Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00970  Aminoacyl-tRNA biosynthesis
oih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oih00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OB0765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oih03029]
    OB0765
Enzymes [BR:oih01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OB0765
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OB0765
Mitochondrial biogenesis [BR:oih03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OB0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAC12721
JAMSTEC: OB0765
UniProt: Q8ES78
Position
816300..817766
Genome map
AA seq 488 aa AA seqDB search
MSLFDYTIKELEEKLHNKEITVEDLVKESYQRIHEVDQEVHAFLTLDEEKALEKARELDQ
LEDKTGILFGMPGGIKDNIVTKGLRTTCASQFLDNFNDPLYDATVVQKLQKENMVAVGKL
NMDEFAMGSSNENSGYEPTRNPWNTEHVPGGSSGGSAAAVAAGEVLFTLGSDTGGSIRQP
AAFCGVVGMKPTYGRVSRFGLVAFASSLDQIGPVTRTVEDNARVLEVIAGHDQMDTTSAN
VEVPSYTEALKQDVKGLKIAVPKEYLAEGVSKEVKDAILEALKVYESMGATWEEVSLPHS
KYALATYYLLSSSEASANLARFDGVRYGVRSENADNMIDMFKKSRSEGFGEEVKRRIMLG
TFALSSGYYDAYYKKAQKVRTLIKNDFDKILEEYDVIVGPTTPTPAFKVGEKTSDPLTMY
ANDILTIPVNLAGVPGISIPCGFSTEGLPIGLQIIGNYFDESTVYRTAYAYEQATEHHKK
RPQLGGAK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatttgattacactataaaagaattagaagaaaagctacataataaagaaatt
acggttgaagatctagttaaagaatcctatcaacgtattcatgaggtagatcaagaggtc
catgcttttcttacgttagatgaagaaaaagcgttagaaaaagcgagagaattagatcaa
cttgaagataaaacaggtatcttatttggaatgcctggtggtattaaagataatattgta
acaaaaggacttcgtacaacttgtgcaagtcaattcttagataatttcaatgatccatta
tatgatgcgactgttgttcaaaagttacagaaagaaaacatggttgctgttggtaagttg
aatatggatgaatttgccatgggctcttccaatgaaaactctggttatgaaccaactcgt
aatccttggaatacagaacacgtaccaggtggatctagtggtggttctgctgccgcagta
gctgcaggagaggtactattcacattaggctctgatacgggtggttcaattcgtcaacca
gcagcattctgtggagtagtcggtatgaaaccaacgtacggaagagtttcacgttttgga
ttggttgcttttgcatcttctcttgatcagattggaccagttactcgtacagtagaagat
aatgcacgcgtacttgaagttattgctgggcatgaccaaatggatacaactagtgcgaat
gtagaagttccttcctatacagaagcgttaaaacaagatgtaaaaggacttaaaatcgct
gtaccaaaagaatatcttgcagaaggtgtatcgaaagaagtaaaagacgcgattttagaa
gcattaaaggtatatgaatccatgggtgctacatgggaagaagtttccttgccgcattct
aaatatgcactagcaacttactatttactttcatcttcagaggcgtctgctaacttagct
cgttttgatggcgtacgttacggtgtgcgttcagagaatgcagataacatgattgatatg
ttcaaaaaatcccgtagtgaaggatttggagaagaagtaaagcgtcgtattatgttagga
acctttgcgcttagctctggttactatgatgcttattataaaaaagcacaaaaagtacgt
acattaataaaaaatgattttgataaaattttagaggaatatgatgttatcgttgggcca
acaactccaactccagcatttaaagtcggagaaaaaacaagtgatccattaacgatgtat
gcgaacgacattttaactattccagttaacttagctggtgtaccaggaatttctattcca
tgtggattctctacagaaggtctacctatcgggttacaaattataggtaactatttcgat
gaaagcacagtataccgtacagcttacgcatatgaacaagcaacggaacatcacaagaaa
agacctcaacttggaggtgcaaaataa

DBGET integrated database retrieval system